KEGG   Variovorax paradoxus S110: Vapar_2710Help
Entry
Vapar_2710        CDS       T00916                                 

Definition
(GenBank) hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2853921..2854190)
Genome map
AA seq 89 aa AA seqDB search
MNIYPDQHIGGPPAPADWTMAVGVEGLGEGTCYFADIRRGGDPVCRLMITGTLAEEEEAR
ALLAVKVRLWIAEYISRQHSGATTFGVLE
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttatccagaccagcacatcggcggcccgcccgcgccggcagactggaccatg
gcggtgggcgtggaaggactcggggagggaacctgctatttcgcagacatccggcgcggt
ggcgatccagtttgtcgcctcatgatcaccggcaccttggcagaagaagaagaagcgcgg
gcgcttctggcggtcaaggttcgtctgtggatcgccgaatacatctcgcggcaacacagt
ggcgcaacaacattcggcgtcttggagtaa

DBGET integrated database retrieval system