KEGG   Variovorax paradoxus S110: Vapar_2717Help
Entry
Vapar_2717        CDS       T00916                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00300  Lysine biosynthesis
vap01100  Metabolic pathways
vap01120  Microbial metabolism in diverse environments
vap01230  Biosynthesis of amino acids
Module
vap_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Vapar_2717
Enzymes [BR:vap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Vapar_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACS19339
JGI: Vapar_2717
UniProt: C5CLT2
Position
1:complement(2861987..2863162)
Genome map
AA seq 391 aa AA seqDB search
MSRTLQLAEQLISRPSVTPDDAGCQQILGERLARLGFTLETIESGPADFRVTNLWAVRRP
AGTAPTKTLVFAGHTDVVPTGPVEQWTSHPFTPTHRGGKLYGRGACDMKTSVAAFVVSIE
EFLAATPDPRLTLALLLTSDEEGPGVDGTVIVCNALAARGETIDYCIVGEPTAVERCGDM
IKNGRRGTMSGKLTVHGVQGHIAYPHLAKNPVHAVAPALAELVAINAAGGWDAGNAYFQP
TSWQISNFHAGTGASNVIPGSAVIDFNFRFSTESTPESLQKRVHAVLDAHGVDCTLAWTI
GGLPFLTTPGELVSAVQAAIADETGIATELSTSGGTSDARFIAKICKQVVELGPVNASIH
KIDEHIDVAEIETLKNIYKRTLERLEASLIQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaccctccagctcgccgaacaactcatctcgcgcccctcggtcacccccgac
gatgcgggctgccaacagatcctcggcgaacggctggcacggctgggcttcacgctcgaa
accatcgaaagcggcccggccgattttcgcgtgaccaacctgtgggcggtgcgccgtccg
gccggcaccgcgccgacgaagacgctggtgttcgcaggccacaccgacgtggtgcccacg
gggccggtcgagcagtggaccagccatccgttcacgcccacccaccgcggcggcaagctc
tatggccgcggcgcatgcgacatgaagacatcggtcgcggccttcgtggtctccatcgag
gaattccttgcggccacgcccgatcccaggctcacgctcgcgctcctgctcaccagcgac
gaggaaggcccgggcgtcgatggcacggtcatcgtctgcaacgcgctggccgcgcgtggc
gaaaccatcgactactgcatcgtcggcgaacccacggccgtcgagcgctgcggcgacatg
atcaagaacggccgccgcggcaccatgagcggcaagctcacggtccatggcgtgcagggc
cacatcgcctacccgcacctcgcgaagaacccggtgcatgccgtggcgcccgcactggcg
gagctggtggccatcaacgccgcgggcggctgggacgcgggcaatgcgtacttccagccc
accagctggcagatcagcaactttcatgcgggcaccggcgcgagcaacgtgattccgggc
agtgcggtcatcgacttcaatttccgcttctcgaccgaatcgacgcccgagtcgctgcaa
aagcgcgtgcatgcggtgctcgatgcgcacggcgtggactgcacgctggcctggaccatc
ggcggcctgccttttctcacgacgccgggcgaactcgtcagcgcggtgcaggcggccatt
gccgacgaaaccggcatcgccaccgagctctcgaccagcggcggcaccagcgatgcgcgc
ttcatcgccaagatctgcaagcaggtggtcgagctcggcccggtcaatgccagcatccac
aagatcgacgagcacattgacgtggccgagatcgagacgctgaagaacatctacaagcgc
acgctggagcgcctcgaagcgtcgctcatccaatga

DBGET integrated database retrieval system