KEGG   Variovorax paradoxus S110: Vapar_2723Help
Entry
Vapar_2723        CDS       T00916                                 

Definition
(GenBank) ATP-dependent helicase HrpA
  KO
K03578  
ATP-dependent helicase HrpA [EC:3.6.4.13]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Vapar_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:2868687..2872556
Genome map
AA seq 1289 aa AA seqDB search
MTTTTPSAPLRIDFPESLPVSGRRDEIMAAIAAHQVVIVCGETGSGKTTQLPKIALALGR
GKLNAPPGQGRLIGHTQPRRIAASSVAKRIAEELKTPLGDVVGFKVRFQDRLSRDASVKL
MTDGILLAETQTDPLLKAYDTLIIDEAHERSLNIDFLLGYLREILPRRPDLKVIVTSATI
DAERFAQHFASAKGPAPTIMVSGRTFPVEQRYRPFEESREHDLNDAIADGVDELWRDPHN
AGDILVFLPGEREIREAADHLRRHLSHQPLLRNAEVLPLFARLSGPEQDRIFDSHSGRRI
VLATNVAETSLTVPGIRYVIDTGTARVKRYSFRSKVEQLLVEPISQAAANQRAGRCGRVA
NGICIRLYDEKDFEGRPRFTDPEILRSSLAGVILRMKSLRLGDVARFPFLEAPSPRAIAD
GYQLLNELGAVDDANELTATGAELARLPLDPRVGRMILEARTRGALEEVLVIASALSVQD
VRDRPMDAQQQADQAHSKFDDEKSEFSGYLRLWKWIADARGGHGDTHKLSNRQYEQLLRQ
NFINIRRVREWRDIHSQLLTVVTEHKWRINAEPAGYEPLHLSMLAGLLGNVGWKLEDDEA
YLGARGIKFYKHPGAHLKKKPGRWIVAAELVETTRLFGRGIANIEPQWLEQVAGHLLKKQ
LLDPHWEKKGAQVSALERATLYGLVVYSGRRVDFTKVDPVAAREIFIREALVGGQWESKF
PFLAANRKLVREVEGLEHKARRQDVLVDDELIFAFYDAQLPADVASGISFENWYRHASRE
QPRLLFLTREELMRHQAAGITTQSFPPTLRLGGVDCAASYLHAPGDAKDGLTVSVPLFVL
NQVSEERCEWLVTGMLKDKIQALLKSLPQRPRSRLVPLPESAARLAEELSAPEVFGHGSL
TDVLLKRVRDTTSIDVKRADFKLDMLPPHLFMNLRIVDEHGRQLGMGRNLGALKAELGAQ
ARGAFQALAGLNVKASADRKPADAAEGHGQAKGNAAAPAPAAPSLPAGQRYTNWSFGELP
ELMEVRRGSQSLIGFPALRDEGDAVTIEVFDEPAVAAAKHRAGLRRLFALQLKDALKYLE
KNIPDLQKMAVAYMPLGTSEELRAQIIDVAIDRAFLQEPLPTDEFAFKRRLEEGRGRLTL
IANEVARLASAILAEYAAAARKIKDTKLQPEAVQDAAQQLQRLVGKRFIADAPWTQLQHF
ARYLKAIVLRLDKLRSDPARDAAKLAELRPQEQRYWRLVAERKGVVDERMLEFRWLLEEL
RVSFFAQELRTPQPVSIKRLDKAWAQLQA
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaccacgacaccttccgcccccttgcgcatcgactttcccgaatcgcttccggtc
tccggccggcgcgatgaaatcatggccgccatcgcggcgcaccaggtggtgatcgtctgc
ggcgaaacgggctcgggcaagaccacccagttgccgaagatcgcgctggcgctcggccgc
ggcaagctcaatgcgccgccgggccagggccggctcatcggccacacgcagccgcggcgc
attgccgccagctcggtggccaagcgcatcgccgaagagctgaagacgccgctgggcgac
gtggtcggcttcaaggtgcgcttccaggaccggctgagccgcgacgcgtcggtcaagctc
atgaccgacggcatcctgctggccgagacgcagaccgatccgctgctcaaggcctacgac
acgctgatcatcgacgaggcgcacgagcgctcgctcaacatcgacttcctgctcggctac
ctgcgcgagatccttccgcgccggcccgacctgaaggtgatcgtgacctcggccaccatc
gacgccgaacgcttcgcgcagcatttcgcctcggcaaaaggcccggcgccgacgatcatg
gtgtccgggcgcaccttcccggtcgagcagcgctaccggcccttcgaggagtcgcgcgag
cacgacctgaacgacgccattgccgacggcgtcgacgagctctggcgcgatccgcacaac
gccggcgacatcctggtcttcctgcccggcgagcgcgagatccgcgaggccgccgaccac
ctgcgccgccacctgagccaccagccgctgctgcgcaacgccgaggtgctgccgctgttc
gcgcggctgtcgggccccgagcaggaccgcatcttcgacagccattcgggccggcgcatc
gtgctggccaccaacgtggcggaaacctcgctcaccgtgccgggaatccgctacgtgatc
gacaccggcacggcgcgcgtgaagcgctacagcttccgcagcaaggtcgagcagctgctg
gtcgagccgatcagccaggcagcggccaaccagcgcgccggccgctgcggccgcgtggcc
aacggcatctgcatccggctctacgacgagaaggatttcgaaggccggccgcgcttcacc
gacccggaaatcctgcgctcgtctctcgcgggcgtgatcctgcgcatgaagtcgctgcgg
ctgggcgacgtggcgcgctttccgtttctcgaggcgccctcgccgcgcgcgattgccgac
ggctaccagctgctcaacgagctcggcgcggtcgacgacgccaacgaactcacggccacg
ggcgccgagctcgccaggctgccgctcgatccgcgcgtgggccggatgattcttgaagcc
cgcacgcgcggcgcgctcgaagaggtgctggtcatcgcgtcggcgctcagcgtgcaggac
gtgcgcgaccggccgatggacgcgcagcagcaggccgaccaggcgcattccaagttcgac
gacgagaagagcgagttcagcggctacctgcggctgtggaaatggatcgccgatgcgcgc
ggcggccatggagacacccacaagctcagcaacaggcagtacgagcagctgctgcgccag
aacttcatcaacatccgccgcgtgcgcgaatggcgcgacatccattcgcagctgctcacg
gtggtcaccgagcacaagtggcgcatcaacgccgagccggccggctacgagccgctgcac
ctgtcgatgctcgcgggcctgcttggcaacgtcggctggaagctggaagacgacgaggcc
tacctgggtgcgcgcggcatcaagttctacaagcatccgggcgcgcacctgaagaagaag
cccggccgctggatcgtcgcggccgagctggtcgagaccacgcggctcttcggccgcggc
attgccaacatcgagccgcagtggctcgaacaggtggccggccacctgctgaagaagcag
ctgctcgatccgcattgggagaagaagggcgcgcaggtttcggcgctggagcgcgcaacg
ctctacggcctcgtggtgtacagcgggcgccgcgtcgacttcacgaaggtggacccggtg
gcggcgcgcgagatcttcatccgcgaagcgctggtcggcgggcagtgggagagcaagttt
ccgttcctcgcggccaaccgcaagctggtgcgcgaggtcgaagggctggagcacaaggcg
cgccggcaggacgtgctggtcgacgacgagctgatcttcgccttctacgacgcgcagctg
cccgccgacgtggccagcggcatcagcttcgagaactggtaccgccatgcctccagggag
cagccgcgcctgctcttcctcacgcgcgaggaactgatgcgccaccaggccgcgggcatc
accacgcagtcctttccgcccacgctgcggctgggcggcgtcgactgcgcggcaagctac
ctgcacgcgcctggcgacgccaaggacggcctcacggtcagcgtgccgctcttcgtgctc
aaccaggtgagcgaagagcgctgcgaatggttggtgaccggcatgctcaaggacaagatc
caggcgctgctcaagagcctgccgcagcggccgcgctcgcggctggtgccgctgcccgag
tcggccgccaggctggcggaagagctttcggcgcccgaagtgttcggccacggctcgctg
accgatgtgctgctcaagcgcgtgcgcgacaccacgagcatcgacgtcaagcgtgccgac
ttcaagctcgacatgctgccgccgcatctgttcatgaacctgcgcatcgtggacgagcac
ggtcgccagcttggcatggggcgcaacctgggtgcgctcaaggcggagctgggcgcgcag
gcgcgcggcgcttttcaggcgctggccggcctcaacgtcaaggcgtcggcggaccgcaag
ccggccgacgcagccgagggacacgggcaggccaagggcaacgccgctgcgccggcaccc
gccgcgcccagcctgcctgccggccagcgctacaccaactggagcttcggcgaactgccc
gagctgatggaagtgcggcgcggatcgcagtcgctgatcggatttccggcgctgcgcgac
gagggcgatgccgtcaccatcgaggtgttcgacgagcccgccgtggcggccgccaagcac
cgcgccgggctgcgccgcctgttcgcgctgcagctgaaggatgcgctcaagtacctcgag
aagaacatccccgacctgcagaagatggccgtggcctacatgccgctgggtacctcggag
gagctgcgcgcgcagatcatcgacgtggcgatcgaccgggccttcctgcaggagccgctg
ccgaccgacgagttcgccttcaagcgccgcctcgaagagggccgcggccggctcacgctg
atcgccaacgaggtggcgcggctggcctcggccatcctggccgagtacgcggccgccgcg
cgcaagatcaaggacaccaagctccagcccgaggccgtgcaggacgccgcgcagcagctg
cagcgcctggtcggcaagcgcttcatcgcggacgcgccgtggacgcagctgcagcatttc
gcgcgctatctcaaggccatcgtgctgcggctcgacaagctgcgcagcgaccccgcgcgc
gatgccgccaagctggccgagctgcggccgcaggagcagcgctactggcggctggtggcc
gagcgcaagggcgtggtggacgagcgcatgctggagttccgctggctgctcgaggagctg
cgcgtgagcttcttcgcgcaggagctgcgcacgccgcagccggtcagcatcaagcggctg
gacaaggcctgggcccagctgcaggcctga

DBGET integrated database retrieval system