KEGG   Variovorax paradoxus S110: Vapar_2732Help
Entry
Vapar_2732        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2018
Motif
Other DBs
NCBI-ProteinID: ACS19354
JGI: Vapar_2732
UniProt: C5CLU7
Position
1:2879761..2880168
Genome map
AA seq 135 aa AA seqDB search
MASTLRTPPRFVPTLTTVLDLPAEPPAAEAATPASAPPPPAVDPAEAVALPPAEQRSEAE
IVRLEEQLLHRVLQRVDLSLEERLSDTVSAAVQQQLDAMVPRLREEIEAVLRALVIEAMA
AELSENTGSTPASGA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgctgcgcacgccgccccggttcgttcccacgctgaccacggtgctcgac
ctccccgccgagccgcctgccgccgaggcggcaacgcccgccagcgcgccgccaccaccg
gcggtcgaccccgccgaagccgtggcattgcctccggccgagcagcgttccgaggccgaa
atcgtccgcctcgaagagcagcttctgcaccgcgtgctgcagcgcgtcgacctgtctttg
gaagagcgcctgagcgacacggtctcggccgccgtgcagcagcagctcgatgcgatggtg
ccccggctgcgggaggaaatcgaggccgtgctgcgtgccttggtgatcgaagccatggcc
gccgagctctctgaaaacacagggtctacgccagcttccggcgcataa

DBGET integrated database retrieval system