KEGG   Variovorax paradoxus S110: Vapar_2737Help
Entry
Vapar_2737        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NfeD Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ACS19359
JGI: Vapar_2737
UniProt: C5CLV2
Position
1:complement(2883695..2884120)
Genome map
AA seq 141 aa AA seqDB search
MANSTIWWLIAGAAIVLELLSGTVYLLLLATGFAAAAIAAHLGAGTVSQLVVAAVVGVGA
VLVWYAVQRRRPAAAPTASNRDVNLDIGEIIHVEAWNPDGTATVRYRGAQWTVIPRAGQA
PATGEHRVVEVVGSRLVVDKT
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattccaccatctggtggctgatagcgggagccgccatcgtgctggaattgctg
tccggcacggtctacctgttgctgctggccaccggctttgcggcggcggccattgcggcg
cacctgggtgccggcaccgtttcgcaactggtcgtggcggcggtcgtcggcgtgggggcg
gtcctggtctggtatgcggtccagcgccggcgtccggccgccgcgcccacggcatcgaac
cgcgatgtcaatctggacatcggcgagatcatccacgtcgaggcctggaaccccgacggc
accgccaccgttcgctaccgcggcgcccagtggaccgtgattccgcgtgcgggccaggcc
cccgccaccggcgagcaccgcgtggtcgaggtggtcggcagccgcctcgtggtcgacaag
acctga

DBGET integrated database retrieval system