KEGG   Variovorax paradoxus S110: Vapar_2740Help
Entry
Vapar_2740        CDS       T00916                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00061  Fatty acid biosynthesis
vap00780  Biotin metabolism
vap01100  Metabolic pathways
vap01130  Biosynthesis of antibiotics
vap01212  Fatty acid metabolism
Module
vap_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Vapar_2740
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Vapar_2740
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Vapar_2740
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Vapar_2740
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Vapar_2740
Lipid biosynthesis proteins [BR:vap01004]
 Fatty acid synthase
  Component type
   Vapar_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACS19362
JGI: Vapar_2740
UniProt: C5CLV5
Position
1:complement(2887451..2888233)
Genome map
AA seq 260 aa AA seqDB search
MGFLSGKKLLITGVLSNRSIAYGIAKACHEQGAELAFSYVGERFKDRITEFAADFGSKLI
FDCDVGDDAQIDKLFADLAQAWPRFDGFVHSIGFAPREAIAGDFLEGLSREGFKIAHDIS
AYSFPAMAKAALPYLNDKSALLTLTYLGAERALPNYNTMGLAKASLEASVRYTAASLGPK
GMRVNGISAGPIKTLAASGIKGFGKMLSAVADASPIRRNVTIEEVGNVAAFLLSDLASGV
TAEITYVDGGFSNVVAGMAE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctttccggcaaaaaactgttgatcaccggcgtgttgagcaatcgctccatt
gcctacggcatagccaaggcctgtcacgaacaaggcgccgagcttgctttcagctacgtc
ggcgagcgattcaaggaccgtatcaccgaattcgccgcggacttcggctccaagcttatt
tttgactgcgacgtgggcgacgacgcgcagatcgacaagctctttgccgatctggcgcag
gcgtggcccaggttcgacgggttcgtgcacagcatcggctttgcgccgcgcgaggccatt
gcgggcgacttcctcgaaggcttgtcgcgcgaaggcttcaagattgcgcacgacatcagc
gcctatagcttcccggccatggccaaggcggccctgccctacctcaacgacaagtcggcg
cttctcacgctgacctacctcggcgccgagcgcgcgctgcccaactacaacaccatgggc
ctggccaaggcctcgctcgaggcctcggtgcgctacaccgcggcttcgctcggccccaag
ggcatgcgggtcaacggcatcagcgccgggccgatcaagacgctggcggccagcggcatc
aagggcttcggcaagatgctgtccgccgtggccgacgcctcgcccattcgccgcaacgtg
accatcgaggaagtcggcaacgtggctgccttcctgctgagcgacctggccagcggcgtc
accgccgagatcacctatgtggacggcggcttcagcaacgtcgtggcgggcatggccgag
taa

DBGET integrated database retrieval system