KEGG   Variovorax paradoxus S110: Vapar_2748Help
Entry
Vapar_2748        CDS       T00916                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  
translation initiation factor IF-2
Organism
vap  Variovorax paradoxus S110
Brite
Translation factors [BR:vap03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    Vapar_2748
 Prokaryotic Type
   Vapar_2748
Mitochondrial biogenesis [BR:vap03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Vapar_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:2897353..2900307
Genome map
AA seq 984 aa AA seqDB search
MSSTTVAEFANELKKTPETLLDQLKSAGVPKAAPTDALTEADKQRLLGFLKASHGTAEPE
RKKITLTKKSTSEIKQADATGRARTIQVEVRKKRTFIQRDDGHPATPEVQPVAEAPAAAP
AAPRIDEAELARREEEARRQAELIRRQEEELAEKRRLREEAEAREREQAEKAERAEQAEQ
EAARIAAEKKAADAAAAAPAKEAAKPAAAPVAAAAAAAEQQAADTKLAAQTAATQAKEDA
KAKAAAESKARADEEAARAKDLDERRRKALAEAEAIRAMMNAPARVLVPHKAPEKPQPEK
AAVKGTLHKPAAPAARPGAPAAPGAAAAPGAAGAGKEVKSAKLSSSWAGDPAKKKEIKTR
GDASGGVGRGNWRGGPRGRRGSNDRGGHEEHVQAAPVEARILEVHVPETITVAELAHKMA
VKAQEVIKQLMKLGQMATINQSLDQDTAMILVEEMGHNAVVAALDDPEAFTDEDVSAQTA
EALPRAPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVQTERGMVSFLDT
PGHEAFTAMRARGAQATDIVILVVAADDGVMPQTKEAIKHAKAAGVPIVVAINKIDKPDA
SPDRVKQELVAEEVVPEEYGGDVPFVPVSAKTGQGIDDLLEQVLLQAEVLELKAPVDAAA
KGLVIEAQLDKGRGPVATVLVQSGTLKTGDVVLAGSTYGRVRAMLDEDGRTIKSAGPSIP
VEIQGLTEVPQAGDEFMVMSDERRAREIATYRAGKFRNTKLAKAQAANLQNMFTDLSAGE
VQTLRIIIKADVQGSQEALAQSLLKLATDEVKVQIVYAGVGGISESDINLAIASKAIVIG
FNVRADAGARKLAEGNGVQLNYYSIIYDAVDEIKVAMSGMLAPERREEIIGSAEIRTVFV
ASKIGTVAGSYITSGSVNRSAHFRLLRDNVVIYTGEVDSIKRMKDDVREVREGFECGIKL
KNYNDIKEGDQLEFFEIKEIARTL
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtaccactgtcgccgagttcgcgaacgagctcaagaagactcccgaaaccttg
cttgaccagctcaagagcgcaggcgtgcccaaggcggcacccaccgatgcactcaccgag
gctgacaagcagcgcctgctcggctttctcaaagccagccatggcaccgccgagcccgag
cgcaagaagatcacgctgacgaaaaagtcgaccagcgagatcaagcaggccgacgccacc
ggccgcgcccgcaccatccaggtcgaggtgcgcaagaagcgcaccttcatccagcgcgac
gacggccacccggccacgcccgaagtgcaaccggtggccgaagcgcccgccgcggcgccc
gccgcaccccgcatcgacgaagccgaactggcccgccgcgaggaagaggcgcgccgccag
gccgagctgatccgccgccaggaagaagaactggccgagaagcgccgcctgcgcgaagaa
gccgaagcccgcgaacgcgaacaggccgagaaggccgagcgtgcagagcaggccgagcag
gaagctgcgcgcatcgctgcagagaagaaggccgctgacgcagccgcggccgcgcccgcc
aaggaagcggccaagccggctgctgcgcctgttgcagccgctgcagccgccgccgaacag
caggccgccgacaccaagctggctgcccagaccgccgccacgcaagccaaggaagacgcc
aaggccaaggccgccgccgaatcgaaggcccgtgccgacgaggaagccgcccgcgccaag
gacctggacgagcgccgccgcaaggccctggccgaagccgaagccatccgcgccatgatg
aacgcaccggcccgcgtgctggtgccgcacaaggcgcccgagaagccgcagcccgaaaag
gctgcggtcaagggcacgctgcacaagccggccgcgcccgcagcgcgccccggcgcgccg
gccgcaccgggtgctgccgcagcccccggcgccgccggtgccggcaaggaagtcaagtcg
gccaagctctcgtcgagctgggcgggcgatcctgccaagaagaaggaaatcaagacccgc
ggcgatgccagcggcggtgtcggccgcggcaactggcgcggaggcccgcgcggccgccgt
ggcagcaatgaccgtggaggccacgaagagcacgtgcaggccgcaccggtggaggcgcgc
attctcgaagtgcacgtgcccgaaaccatcacggtggccgagctcgcgcacaagatggcc
gtcaaggcacaggaagtcatcaagcaattgatgaagctgggccagatggcgaccatcaac
cagtcgctggaccaggacaccgccatgatcctggtggaggaaatgggccacaacgcggtc
gttgccgcgctggacgaccctgaagccttcaccgacgaggacgtgtcggcgcaaaccgcc
gaagccctgccgcgcgcaccggtcgtgaccgtcatgggccacgtcgaccacggcaagacc
tcgctgctcgactacatccgccgcgccaaggttgcagcgggcgaagccggcggcatcacg
cagcacatcggtgcctaccatgtgcagaccgaacgcggcatggtgtccttcctcgacacc
ccgggccacgaggccttcacggccatgcgtgcccgcggtgcgcaggccaccgacatcgtc
atcctcgtggtggcggccgacgacggcgtcatgccgcagaccaaggaagccatcaagcac
gcgaaggctgcgggtgtgccgatcgtggttgccatcaacaagatcgacaagcccgatgcc
agcccggaccgcgtgaagcaggaactggtggccgaagaggtggtgcccgaagagtacggc
ggcgacgtgccgttcgtgccggtgtccgccaagacgggccagggcatcgacgacctgctc
gagcaggtgctgctgcaggccgaagtgctggaactcaaggcgccggtggatgccgccgcc
aagggcctggtcatcgaagcgcagctcgacaagggccgcggcccggtcgcgaccgtgctg
gtgcagtccggcacgctcaagaccggcgacgtggtgctggcaggttcgacctatggccgc
gtgcgcgccatgctcgacgaagacggcaggaccatcaagtcggccggcccgtcgatcccg
gtcgagatccagggcctgaccgaagtgccccaggcgggcgacgagttcatggtgatgagc
gacgagcgccgtgcgcgcgaaatcgccacctaccgtgccggcaagttccgcaacaccaag
ctggcgaaggcccaggccgcgaacctgcagaacatgttcaccgacctctcggccggcgaa
gtgcagacgctgcgcatcatcatcaaggccgacgtgcagggctcgcaggaagcgctggcc
cagtcgctgctcaagctggcgaccgacgaggtcaaggtgcagatcgtgtacgccggcgtg
ggcggcatcagcgaaagcgacatcaacctggcgatcgcctccaaggccatcgtgatcggc
ttcaacgtgcgtgccgatgccggcgcgcgcaagctggccgaaggcaatggcgtgcagctg
aactactacagcatcatttacgacgccgtggacgagatcaaggtcgcgatgtcgggcatg
ctggcaccggagcgccgcgaggaaatcatcggctcggccgagatccgcacggtgttcgtg
gcctcgaagatcggtacggtcgcgggttcctacatcacctcgggctcggtcaaccgcagt
gcgcatttccgcctgctgcgcgacaacgtggtgatctacaccggcgaagtcgactcgatc
aagcgcatgaaggacgacgtccgcgaagtgcgcgaaggcttcgagtgcggtatcaagctc
aagaactacaacgacatcaaagagggcgatcagctcgagttctttgaaatcaaggagatc
gcccgtacgctgtaa

DBGET integrated database retrieval system