KEGG   Variovorax paradoxus S110: Vapar_2755Help
Entry
Vapar_2755        CDS       T00916                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
vap  Variovorax paradoxus S110
Brite
Transcription machinery [BR:vap03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Vapar_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 Sigma70_r2 Sigma70_ECF HTH_23 HTH_24 HTH_AsnC-type Tad DUF3780
Motif
Other DBs
NCBI-ProteinID: ACS19377
JGI: Vapar_2755
UniProt: C5CLX0
Position
1:complement(2905820..2906335)
Genome map
AA seq 171 aa AA seqDB search
MDARLLADQIPSLRRYARALTGNVWAADDLVQDTLERACSKWRLWVVGSDLRAWLFTVMH
NIFASQLRRTPPPHSVVPLEDAVQELHGAADPGRDPGMGLDLQRCLMQLPEEQRAVLLLV
TLEDLSYAEVAKVLGIPAGTVMSRLSRARVRLQELMDGAAAPHRPGLRRLK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggacgcccgcctgctggccgaccagatcccgagcctgcgccgctatgcgcgcgcgctc
acgggcaacgtctgggcggccgacgacctggtgcaggacacgctcgagcgggcctgcagc
aagtggcggctctgggtggtgggcagcgacctgcgcgcctggttgttcacggtcatgcac
aacatctttgcgagccagctgcggcgcacgccgccgccgcacagcgtggtgccgctggag
gacgcggtgcaggagctgcacggcgccgccgatccgggccgcgaccccggcatgggcctg
gacctgcagcgctgcctgatgcagctgcccgaagagcagcgcgccgtgctgctgctcgtc
acgctcgaagacctttcctatgccgaggtggccaaggtgctcggcatccccgccggcacc
gtgatgtcgcgcctgtcgcgcgcccgcgtccggctgcaggagctgatggacggcgccgct
gcgccgcatcgccccggactgcgccgcctcaagtga

DBGET integrated database retrieval system