KEGG   Variovorax paradoxus S110: Vapar_2766Help
Entry
Vapar_2766        CDS       T00916                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase 3HCDH_N GDP_Man_Dehyd E1-N
Motif
Other DBs
NCBI-ProteinID: ACS19388
JGI: Vapar_2766
UniProt: C5CLY1
Position
1:2913339..2914073
Genome map
AA seq 244 aa AA seqDB search
MTRLNGKTAVITGGATGIGRAAAKRFIEEGAFVFIFGRRQEALDAAVAELGPNARAVKGS
VSDEADLDRLYAAVKAERGTLDVVFANAGAGSPLALGKITAEHIDETFDTNVKGTIFTVQ
KALPLMSKGGSIILTGSSAGTTGAPAFGAYSASKAAVRNLARTWAEDLKGTGIRVNVLSP
GPTATDLARAVLGEEGMKAFASMNPLQRMADPAEIGAAAAFLASQDSSFMTASEVAVDGG
LAQI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaccagactgaatggaaagaccgccgtgatcaccggcggcgccaccggcatcggccgc
gccgcggcaaagcgcttcatcgaggagggcgccttcgtcttcatcttcggccgccggcag
gaagcgctcgacgccgccgtggccgaactcgggcccaatgcccgcgccgtgaagggctcg
gtctccgacgaggccgacctcgaccggctctacgcggcggtgaaggccgagcgcggaacg
ctcgacgtcgtctttgccaatgccggggcgggaagcccgcttgcgctcggcaagatcacc
gccgagcacatcgacgaaaccttcgacaccaatgtgaagggcacgatcttcacggtccag
aaggcgctgccgctgatgagcaagggcggctcgatcatcctgaccggttcgagcgccggc
accacgggtgccccggcattcggtgcctacagcgcgagcaaggcggccgtgcgcaacctc
gcgcggacttgggcggaggacctcaagggcaccggcatccgggtcaacgtgctgtcaccc
gggccgacagcgaccgacctcgcgagggcagtgctgggcgaggagggcatgaaggccttc
gcatcgatgaatccgctccagcgcatggccgatccggcggagatcggcgcggcggccgcc
tttctcgcgtcgcaggacagcagcttcatgaccgccagcgaggtcgcggtcgacggcggc
ctggcgcagatctga

DBGET integrated database retrieval system