KEGG   Variovorax paradoxus S110: Vapar_2769Help
Entry
Vapar_2769        CDS       T00916                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 EHN
Motif
Other DBs
NCBI-ProteinID: ACS19391
JGI: Vapar_2769
UniProt: C5CLY4
Position
1:complement(2915705..2916622)
Genome map
AA seq 305 aa AA seqDB search
MSSPRHRYISVGGTQIFYREAGPPDAPALLLLHGFPSSSVQFRHLLWTLADRWRLVAPDL
PGLGFSAVPDHRHFAYTFAHLAEVIEGFVRAVGIEPRALYLHDYGAQTGFRLLASAALRP
AALVIQNSEAYFDAGRTDAWSSAEAYWRDPSDANRERMRASLLNEDDIRREFVEQLPAHI
AERIDPAVIRLACDHVQRPGVADALLDLHRDYGSNVAFYPAIQAHLRRARLPTLILWGRG
DQYYRPAQAEAFRQDLPDATIEYFDGGHWLLETHPGEVAAAIRDFLQRHLAPPALRPLHE
MRGVQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgccaaggcaccgatacatcagcgtcggcggcacgcagatcttctaccgcgaa
gcggggccgccggatgcgccggcgcttcttctgctccatgggtttccgtcgtcgtccgtg
cagttccgccatctcttgtggacgctggccgatcgatggcggctcgtcgcacccgacttg
ccgggcttgggattcagcgccgtccccgaccaccgccatttcgcctacaccttcgctcat
cttgccgaggtgatcgaaggctttgtccgggccgtgggcatcgagcctcgcgccctctac
cttcacgactatggagcgcaaactggattccggctgctggcaagcgcggccctgcggccg
gcggctctcgtcatccagaacagcgaggcttatttcgatgcgggccgtaccgatgcatgg
tcgtccgccgaagcctattggcgcgatccctcggatgccaaccgcgagaggatgcgtgct
tcgcttctcaatgaagacgacatccgccgcgagttcgtcgagcagcttcccgcgcacatc
gccgagcgcatcgatcccgcggtcatccgcctggcatgcgaccacgtccagcggccgggc
gtggccgatgcgctgctcgatcttcatcgcgactatgggagcaacgtcgcgttctaccct
gcgatccaggcgcacctgcgccgcgctcgccttccgaccctgatcctctggggacggggc
gaccagtactaccggccagcgcaggcggaggcctttcgccaggacctgccggatgccacg
atcgaatacttcgacggcggccactggcttctcgaaacgcaccctggcgaggtggctgca
gccatccgggatttcctgcagcggcacctcgcgccgccggcccttcgtccacttcacgaa
atgcgaggcgtccaatga

DBGET integrated database retrieval system