KEGG   Variovorax paradoxus S110: Vapar_2777Help
Entry
Vapar_2777        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2924537..2925505)
Genome map
AA seq 322 aa AA seqDB search
MKLMKLLATPVLLAAVVFAVPSLAQTYPARPITLVVPYPPGGSADILARTVGEQLAARLG
QPVIVENKAGAGTAIGARFVADAKPDGYTLLMGTVSSQAINPAMSKVGYDPIKGFAVVSA
LASIPFVLVAHPAAPYSNVAELIAAGRSRPGTISFASAGPGTSNHLAGEMLANAAHVQLL
HVPYRGSAPALADVLAGHVPVMFDLQTTALPNLKAQKVKALAVTSLHRSPLLPDVPTVAE
SGLPDFEVSAWFGIFAPAKVPQPVLKQLSEAMTDVLRAPAMVQRLREIGTEPDTRNAAAF
ASYAAAEVSKYAAIVKSAGLAP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcatgaagctgctcgccaccccggtgctgttggccgcagtcgtcttcgctgtg
ccgtcgctcgcacagacctaccctgcccgcccgatcacgctcgttgttccgtatccgccg
ggaggctcggccgacatcctcgcgcgcactgtcggagagcagctggcggcgcgcctcgga
cagcccgtgatcgtggagaacaaggccggcgccggcaccgccatcggcgcacgtttcgtc
gcagacgccaagcccgacggctacaccttgctcatgggcaccgtcagttcccaggcgatc
aatccggccatgagcaaggtgggctacgacccgatcaagggctttgcagtcgtcagcgca
ctggcatcgattcccttcgtgctggtggcccatcccgccgctccctacagcaatgtggcg
gaactgatcgcagccggcaggagccgccccggcacgatcagctttgcgtcggccggcccc
ggaacatccaaccacctggcgggcgagatgctagcgaacgccgcgcatgtccagctgctg
cacgtgccgtaccgcggcagtgcgccagcgcttgcggacgtgctggccgggcatgtcccc
gtgatgttcgaccttcagaccaccgccctgcccaacctcaaggcccagaaggtcaaggcg
ctggccgtgacaagcctgcatcgcagtccgttgctacccgacgtgcccacagtggcggag
agtggcttgccggatttcgaggtcagcgcctggttcggcatatttgcacccgccaaggtc
ccgcagcctgtactcaagcagctgtccgaggcgatgaccgatgtcctgcgggctcccgcc
atggtgcagcgcctgagggaaatcggcacggagccggatacccggaacgccgcagcgttc
gccagctacgcggcagcggaagtcagcaaatacgcagccatcgtgaaatcagctggcctc
gcaccttga

DBGET integrated database retrieval system