KEGG   Variovorax paradoxus S110: Vapar_2779Help
Entry
Vapar_2779        CDS       T00916                                 

Definition
(GenBank) hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:2926707..2927615
Genome map
AA seq 302 aa AA seqDB search
MQPSLLEEIPAVPNPYPVVSKIEYPEVWRLCTQARDLAWNPIADIDYSDLQKADLPPEVR
KAGAEWWSLRAWMEHGATPYGAERLREAIFQHQPFEVKQHITNFIAEEFRHHEASFRIAD
ALAEYEPMPRSDYFKDIIPRFHDESDEKAMSFFAGLSVNTLFEQLSGDLLQARYENARFD
SIREVCRLILRDEARHIQFGRIIMRRFFSELPSEEKRLIGLKVAKKLRGSLLNGVYAVVN
LPDAERARSGRNRALAADHGLGATHPDEEIGIIRMGVNKIREDIGVYGVEIPAIPEIDSV
VH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgtccctgctcgaagaaattcccgccgttcccaacccctatccggtcgtgtcg
aagatcgaatacccggaggtctggcgcctctgcacccaggcacgcgacttggcctggaac
ccgatcgccgacatcgactattccgatctccagaaggccgatctgccgccggaagtgcgc
aaggcgggcgccgaatggtggagcctgcgtgcctggatggagcacggcgccacgccctat
ggcgcagagcgcctgcgcgaagcgatctttcaacaccagcccttcgaggtgaagcagcac
atcaccaacttcatcgccgaggaattccggcatcacgaggccagcttccgcatcgccgac
gcgctcgccgaatacgagcccatgccgcgttcggactacttcaaggacatcatcccgcgc
ttccacgacgaatcggacgagaaggccatgagcttctttgccggcctctcggtcaacacg
ctgttcgagcagctgtccggcgacctgctgcaggcgcgctacgagaacgcccggttcgac
tcgatccgcgaggtctgccggctgatcctgcgcgacgaggcccgccacatccagttcggc
cgcatcatcatgcggcgcttcttcagcgagttgccctcggaggaaaagcgcctcatcggc
ctgaaggtcgcaaagaagctgcgcggcagcctgctcaacggtgtctatgccgtcgtcaac
ctgccggacgccgagcgcgcacgctccggccgcaaccgggcgctggcggccgaccatggc
cttggcgcgacgcatcccgatgaagagatcggcatcatccgcatgggcgtgaacaagatc
cgcgaggacatcggcgtgtacggcgtcgagatcccggccattccggaaatcgacagcgtc
gtgcactga

DBGET integrated database retrieval system