KEGG   Variovorax paradoxus S110: Vapar_2803Help
Entry
Vapar_2803        CDS       T00916                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vap  Variovorax paradoxus S110
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vap00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Vapar_2803
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Vapar_2803
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Vapar_2803
Two-component system [BR:vap02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Vapar_2803
Bacterial motility proteins [BR:vap02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Vapar_2803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2946033..2946638)
Genome map
AA seq 201 aa AA seqDB search
MKPDARPFPARRVEAVVVGASAGGIEALLALLHGIPPPWRLPVVVVLHLPEGHQSHLAEI
FAERLHMPVHEAADKMPVAPDSLYFAPPGYHLSIERDRCFSLSCEPPVHFSRPSIDVLMA
SAADAYGPALAGFLLTGANDDGAEGLLRIHMAGGLTAVQDPEEAQIPTMPRAAIARHSPD
HVLALRELRTLLLQLESAHAH
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggatgcccgccccttccctgcgcggcgcgtcgaggccgtggtggtcggcgcg
tccgcgggcggcatcgaggcgctgctggcgctcctgcacggcattccaccgccgtggcgg
cttccggtggtggtggtcctgcacttgcccgaaggccaccagagccacctggccgagatc
tttgccgagcggctgcacatgccggtgcacgaggccgccgacaagatgccggtcgcgccc
gacagcctgtacttcgcgccgcccggctatcacctgtcgatcgagcgcgatcggtgcttt
tcgctcagctgcgaaccgcccgtgcacttttcgcggccgtcgatcgacgtgctgatggcc
tcggccgccgatgcctacggccccgcgctcgccgggttcctgctcacgggcgcgaacgac
gacggcgccgaaggcctgttgcgcattcacatggccggcggcctcactgccgtccaggac
ccggaggaagcccagattcccaccatgcccagggcagccattgcccgccattcccccgat
cacgtgcttgccctgcgcgagcttcgcacattgctgctgcaactggagtccgcccatgcc
cattga

DBGET integrated database retrieval system