KEGG   Variovorax paradoxus S110: Vapar_2803Help
Entry
Vapar_2803        CDS       T00916                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vap  Variovorax paradoxus S110
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vap02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vap02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2946033..2946638)
Genome map
AA seq 201 aa AA seqDB search
MKPDARPFPARRVEAVVVGASAGGIEALLALLHGIPPPWRLPVVVVLHLPEGHQSHLAEI
FAERLHMPVHEAADKMPVAPDSLYFAPPGYHLSIERDRCFSLSCEPPVHFSRPSIDVLMA
SAADAYGPALAGFLLTGANDDGAEGLLRIHMAGGLTAVQDPEEAQIPTMPRAAIARHSPD
HVLALRELRTLLLQLESAHAH
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggatgcccgccccttccctgcgcggcgcgtcgaggccgtggtggtcggcgcg
tccgcgggcggcatcgaggcgctgctggcgctcctgcacggcattccaccgccgtggcgg
cttccggtggtggtggtcctgcacttgcccgaaggccaccagagccacctggccgagatc
tttgccgagcggctgcacatgccggtgcacgaggccgccgacaagatgccggtcgcgccc
gacagcctgtacttcgcgccgcccggctatcacctgtcgatcgagcgcgatcggtgcttt
tcgctcagctgcgaaccgcccgtgcacttttcgcggccgtcgatcgacgtgctgatggcc
tcggccgccgatgcctacggccccgcgctcgccgggttcctgctcacgggcgcgaacgac
gacggcgccgaaggcctgttgcgcattcacatggccggcggcctcactgccgtccaggac
ccggaggaagcccagattcccaccatgcccagggcagccattgcccgccattcccccgat
cacgtgcttgccctgcgcgagcttcgcacattgctgctgcaactggagtccgcccatgcc
cattga

DBGET integrated database retrieval system