KEGG   Variovorax paradoxus S110: Vapar_2826Help
Entry
Vapar_2826        CDS       T00916                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
vap  Variovorax paradoxus S110
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Vapar_2826
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Vapar_2826
Enzymes [BR:vap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Vapar_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2971257..2973608)
Genome map
AA seq 783 aa AA seqDB search
MTEHDDFALLDAWWRAANYLSVGQIYLMDNPLLREKLSLSHIKPRLLGHWGTTPGLNFVY
AHMNRAIAARELDAIFVAGPGHGGPGVVANTYLEGTYSEVYPAIGQDADGMKRLFTQFSF
PGGIPSHVAPETPGSIHEGGELGYSLLHAYGAVFDNPGLLACCVIGDGEAETGALAASWH
SNKFLNPESDGAVLPILHLNGYKIAGPTVLARIPDEELAQLLRGYGHEPYFVAGHEPAQM
HRLMAAALDKALDGIDAIQANARKNGFRERPRWPMIVLRSPKGWTGPRQVDGVPVEGTFR
AHQVPLTGFAAKPAHVGLLEDWMRSYRPEELFDEGGALRPEIAALAPKGARRMSANPHTN
GGLLLRDLAMPPFREHAVAVATPGAADAEATRVAGQFLREVMRRNEAARNFRVMGPDETT
SNRLGALFEVTARTSTAEILPGDDHVSPEGRVMEVLSEHLCQGWLEGYLLTGRHGFFSCY
EAFIHIVDSMFNQHAKWLKVTRGIGWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFLDHV
VNKKAEVVRVYLPPDANTLLSVADHCLKSRNYVNVIVAGKQPGPQWLDIESAVRHCTVGL
GIWTWASNDQDAAPDVVMACAGDVPTLETLAAVDLLRRMLPELKVRVVNVVDLMALQSPD
AHPHGLPHAEFDAIFTTDRPVVFAFHGYPSLVHRLTYKRTNHDNFHVHGYCEEGTTTTPF
DMTVLNRLDRFHLAADAIARVERFRDSAGHVQQHLRDKLLEHRAYVTVHGKDMPEIEDWR
WAG
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcacgacgacttcgcgctgctggacgcctggtggcgcgcggccaactacctg
tccgtgggccagatctacctgatggacaacccgctgctgcgcgagaagctgagcctttcg
cacatcaagccgcggctcttgggccactggggcacgacgccgggcctcaatttcgtctat
gcgcacatgaaccgcgccatcgcggcgcgcgagctcgacgccatcttcgtcgccggcccc
ggccacggcggcccgggcgtggtcgccaacacctatctcgagggcacctacagcgaggtc
taccccgccatcggccaggatgccgacggcatgaagcggctcttcacgcagttctcgttc
ccgggcggcattccgagccacgtggcgcccgaaacgccgggctcgatccacgaaggcggc
gagctcggctattcgctgctgcatgcctacggcgcggtgttcgacaaccccggcctgctc
gcctgctgcgtgatcggcgatggcgaggccgagaccggtgcgctcgcggcaagctggcat
tccaacaagttcctgaaccccgagagcgacggcgccgtgctgccgatcctgcacctgaac
ggctacaagatcgccggccccacggtgctcgcgcgcattccggacgaagagctggcgcaa
ctgctgcggggctacgggcacgagccctacttcgttgccggccacgagcctgcgcagatg
caccggctgatggcggccgcgctcgacaaggcgctcgacggcatcgacgccatccaggcc
aatgcccggaagaacggcttccgcgagcggccgcgctggccgatgatcgtgctgcgttcg
cccaagggctggaccgggccgcggcaggtggacggcgtgccggtcgagggcaccttccgc
gcgcaccaggtgccgctcaccggctttgccgccaagccggcgcatgtgggcctgctcgaa
gactggatgcgcagctaccggcctgaggaattgttcgacgaaggcggcgcgttgcgcccc
gagatcgcggcgctggcgcccaagggagcgaggcgcatgagcgccaatccgcacaccaac
ggcggcctgctgctccgggacctggccatgccgcccttccgcgagcatgcggtggcggtg
gccacgcccggcgccgcggatgcggaggccacgcgcgtggcgggccagttcctgcgcgag
gtgatgcgccgcaacgaggcggcgcgcaacttccgcgtcatggggccggacgaaaccacg
tcgaaccggctgggcgcgctgttcgaggtcacggcgcggacttccaccgccgagatcctc
cccggcgacgaccatgtgtcgcccgaaggccgcgtgatggaggtgctgagcgagcacctg
tgccagggctggctcgaaggctacctgctcaccgggcgccatggcttcttctcgtgctac
gaggccttcatccacatcgtcgactcgatgttcaaccagcatgccaagtggctcaaggtg
acgcgcggcatcggctggcgccgtccgatcgcctcgctcaactacctgctcaccagccat
gtctggcggcaggaccacaacggcttcagccaccaggacccgggctttctcgaccacgtg
gtgaacaagaaggccgaggtggtgcgcgtgtacctgccgcccgatgccaacacgctgctg
tcggtggccgaccattgcctgaagagccgcaattacgtgaacgtgatcgtcgcgggcaag
cagccggggccgcagtggctggacatcgaatcggcggtgcgccactgcaccgtgggcctg
ggcatctggacctgggccagcaacgaccaggatgccgcccccgacgtggtgatggcctgc
gccggcgacgtgcccacgctcgagacgctggcggccgtcgacctgctgcgcaggatgctg
ccggaactgaaggtgcgcgtggtgaacgtggtcgacctgatggcgctgcagtcgcccgat
gcgcatccgcacggcctgccgcatgcggagttcgacgccatcttcaccaccgaccgcccg
gtggtcttcgcgttccacggctatccctcgctggtccaccggctcacctacaagcgcacc
aaccacgacaacttccatgtgcacggctactgcgaggaaggcaccaccaccacgccgttc
gacatgaccgtgctcaaccggctcgaccgcttccacctggcggccgacgccattgcgcgc
gtggagcgctttcgcgacagcgcgggccatgtacagcagcatctgcgcgacaagttgctg
gagcaccgcgcctacgtcaccgtgcacggcaaggacatgccggagatcgaggactggcgc
tgggcgggctga

DBGET integrated database retrieval system