KEGG   Variovorax paradoxus S110: Vapar_3399Help
Entry
Vapar_3399        CDS       T00916                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vap00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3579769..3581262
Genome map
AA seq 497 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDREGRIVAIAQKELTQIYPRPGWVEHDPMEIWHSQLATARD
VLAKAKLQPADIHAIGITNQRETTLLWNRKTGQPVHHAIVWQDRRAEPMCAQLRDQGMAA
TIQEKTGLVIDAYFSGTKLRWLLDNVPGARAQAERGELAFGTVDSWLMWQLTGGKVHVTD
VSNASRTMLFNVHRNEWDADLLKALDIPAALMPSVQPSSSHFADTDAALLGRALPIGGVA
GDQQSALFGQACFAAGMAKNTYGTGCFLLMHTGGECQPSHNGLLVTSAAQTSATPQYAME
GSVFVGGAVVQWLRDGLKAIKGSAEVQSLAESVPDAGGVMMVPAFTGLGAPYWDADARGT
ITGLTRGTTVAHIARAALESIAYQSAALLQAMSRDAVAAGGTPVAELRVDGGASVNDLLM
QFQADLLGIPVVRPEVIETTALGAAYLAGLSTGVYSDARQLSKLWKVERRFMPTMGRAQA
EESMARWERAVRQATAT
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgctcgccctcgaccaaggcacctccagctcccgcagcatcgtgttcgac
cgcgaaggccgcatcgtcgccatcgcgcagaaggagctcacgcaaatctatccgcggccc
ggctgggtcgaacacgacccgatggagatctggcacagccagcttgccaccgcgcgcgac
gtgctcgccaaggccaagctccagcccgcggacatccacgccatcggcatcaccaaccag
cgcgagaccaccctgctgtggaaccgcaagaccggccagcccgtgcaccacgccatcgtc
tggcaggaccggcgcgccgagccgatgtgcgcgcagctgcgcgaccagggcatggccgcc
accatccaggagaagaccgggctcgtcatcgacgcctatttttccggcaccaagctgcgc
tggctgctcgacaacgtgcccggcgcgcgcgcgcaggccgagcgcggcgaactcgccttc
ggcaccgttgacagctggctcatgtggcagctcaccggcggcaaggtgcacgtgaccgac
gtgagcaacgcctcgcgcaccatgctcttcaacgtgcaccgcaacgaatgggatgccgac
ctgctcaaggcgctcgacattcccgcggcgctcatgcccagcgtgcagccgtcgagctcg
cactttgccgacaccgacgccgccctgctcggccgcgcgctcccgatcggcggcgtggcc
ggcgaccagcagagcgccctcttcggccaggcctgctttgcggccggcatggccaagaac
acctacggcaccggctgcttcctgctgatgcacaccggcggcgaatgccagccctcgcac
aacggcctgctcgtgaccagcgccgcgcagaccagcgccacgccgcagtacgcgatggaa
ggcagcgtgttcgtcggcggcgccgtggtgcagtggctgcgcgacggcctgaaggccatc
aagggcagcgcggaagtgcagtcgctcgccgaaagcgtgcccgatgcgggcggcgtgatg
atggtgccggccttcaccggcctgggcgcgccctactgggacgccgatgcgcgcggcacc
atcaccggcctcacgcgcgggaccacggtggcacacatcgcgcgcgccgcgctcgagagc
atcgcctaccagagcgccgcgctgctgcaggccatgagccgcgatgcggtggcggccggc
ggcacgcccgtcgctgaactgcgcgtggacggcggcgcgagcgtgaacgacctgctgatg
cagttccaggccgacctgctgggcattcccgtggtgcggcccgaagtgatcgagaccacc
gcgcttggcgcggcgtacctggcgggcctgtcgaccggcgtctacagcgacgcgcggcag
ctgtcgaagctgtggaaggtggagcggcgcttcatgccgaccatgggccgcgcgcaggcc
gaggaatcgatggcgcgctgggagcgcgcggtgcggcaggccacggcgacctga

DBGET integrated database retrieval system