KEGG   Variovorax paradoxus S110: Vapar_3443Help
Entry
Vapar_3443        CDS       T00916                                 

Gene name
pyrG
Definition
CTP synthetase (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
vap  Variovorax paradoxus S110
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Vapar_3443 (pyrG)
Enzymes [BR:vap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     Vapar_3443 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3629490..3631169
Genome map
AA seq 559 aa AA seqDB search
MTKFVFVTGGVVSSLGKGIASASLAAILESRGLKVTLIKLDPYINVDPGTMSPFQHGEVF
VTDDGAETDLDLGHYERFITTRMRKANNFTTGQIYKTVLEKERRGDYLGKTVQVIPHITN
EIQEYIKRGAGLGTAHEVDVAIVEIGGTVGDIESLPFLEAVRQMSLRMGPNNSAFVHLSY
VPWIAAAGELKTKPTQHTAKELRAIGIQADALLCRADRPIPDDERAKISLFSNVPEWGVI
SMWDVDTIYKVPRMLHEQGLDGLICDKLRINTPPAKLQRWDELVYEVEHPQQEVSIAMVG
KYVDLSDSYKSLNEALRHAGMKNHARVKIDYIDSETISPQDVSRLAKYDAILVPGGFGQR
GVEGKISAARFAREGKVPYLGICLGMQVATIEYARHVAGLKNANSTEFDPETPCPVIALI
TEWKDADGTVKTRNEKSDLGGTMRLGAQSSDVSAGTLAHSIYGDVVTERHRHRYEANVNY
LDELRAAGLVISALTQREHLTEIVELPQDVHPWFMGVQFHPEFKSTPWSGHPLFNAFIKA
ALDHKARSAGGAKNLKAVA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatttgtcttcgtcaccggtggtgtcgtatcttcccttggcaagggaatcgcc
tccgcctccctcgccgcgatcctcgaatcgcgcggcctcaaggtcaccctcatcaagctc
gatccgtacatcaatgtcgaccccggcacgatgtcaccgttccagcatggcgaggtgttc
gtcaccgacgacggtgccgagaccgacctcgacctcggccactacgagcgcttcatcacc
acgcggatgcgcaaggccaacaacttcaccactggccagatctacaagaccgtgctcgag
aaggagcgccgcggcgactacctgggcaagacggtgcaggtgattccgcacatcaccaac
gagatccaggaatacatcaagcgcggcgccggcctgggcaccgcgcatgaggtggacgtg
gccatcgtcgagatcggcggcacggtgggcgacatcgaatcgctgcccttcctcgaagcc
gtgcgccagatgagcttgcgcatgggcccgaacaactcggccttcgtgcacctctcctac
gtgccgtggatcgccgccgccggcgagctcaagaccaagcccacgcagcacaccgccaag
gagctgcgcgccatcggcatccaggccgacgcgctgctgtgccgcgccgaccgcccgatt
cccgacgacgagcgcgccaagatctcgctgttctcgaacgtgcccgaatggggcgtgatc
tccatgtgggacgtcgacaccatctacaaggtgccgcgcatgctgcacgagcagggcctg
gacggcctgatctgcgacaagctgcgcatcaacacgccgccggccaagctgcagcgctgg
gacgagctggtgtacgaggtcgagcatccgcagcaggaagtcagcatcgcgatggtcggc
aagtacgtcgacctgtccgacagctacaagtcgctgaacgaggcgctgcgccacgccggc
atgaagaaccatgcgcgcgtgaagatcgactacatcgactccgaaaccatttccccgcaa
gatgtctcgcggctcgccaagtacgacgcgatcctggtgcccggcggcttcggccagcgc
ggcgtcgagggcaagatctcggccgcccgcttcgcgcgcgaaggcaaggtgccctacctc
ggcatctgcctgggcatgcaggtggccaccatcgaatacgcgcgccatgtggcgggcctc
aagaacgccaacagcaccgagttcgaccccgagacgccctgccccgtgatcgcgctgatc
accgaatggaaggacgccgacggcaccgtgaagacgcgcaacgagaagtccgacctcggc
ggcaccatgcgcctgggcgcgcaaagctccgacgtctcggccggcacgctggcccacagt
atctacggcgacgtggtgaccgaacgccaccgccaccgctacgaagccaacgtcaactac
ctcgacgaactgcgcgccgccggcctggtcatttccgcgctgacgcagcgcgagcacctg
accgagatcgtcgagctgccgcaggacgtgcacccgtggttcatgggtgtgcagttccac
cctgaattcaagtcgacgccgtggagcggccatccgctcttcaatgccttcatcaaggcg
gcgctcgaccacaaggcccggagcgcgggcggcgcaaagaacctgaaggcggttgcatga

DBGET integrated database retrieval system