KEGG   Variovorax paradoxus S110: Vapar_3446Help
Entry
Vapar_3446        CDS       T00916                                 

Definition
enolase (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:vap01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vap01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vap00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:vap00680]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:vap03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3632345..3633628
Genome map
AA seq 427 aa AA seqDB search
MSAIVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKKRYL
GKGVLKAVENINTEISESVLGLDASEQAFLDRTMIDLDGTDNKGRLGANATLAVSMAVAR
AAAEESGLPLYRYFGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVR
YGAEVFHALKKILGDRGISTAVGDEGGFAPSVESHEAAIQLILEAIDKAGFVAGEQIALG
LDCAASEFYKDGNYVLSGENLTLSAGNWADMLATWVDKYPIISIEDGMHEGDWDGWKLLT
ERLGKRVQLVGDDLFVTNTKILQEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGYT
AVISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIASYPGR
GAFYNLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaatcgtagacatcgtcggccgtgaaatcctcgacagccgcggcaatcccacc
gtcgagtgcgacgttctgctcgaatcgggcaccatgggccgcgcggccgtgccctcgggc
gcatcgaccggttcgcgcgaagccatcgagctgcgcgacggcgacaagaagcgctacctc
ggcaagggcgtgctcaaggcggtggagaacatcaacaccgagatctcggaatccgtgctc
ggcctggacgccagcgagcaggccttcctcgaccgcacgatgatcgacctggacggcacc
gacaacaagggccgcctgggcgccaacgccaccctcgccgtctcgatggcggtggcacgc
gccgcggccgaggagtcgggcctgccgctgtaccgctacttcggcggcatgggcggcatg
cagctgccggtgccgatgatgaacgtcatcaacggcggcgcgcacgccaacaacagcctg
gacctgcaggagttcatgatcatccccgtgggcgcgccgagcttccgcgaagccgtgcgc
tacggcgccgaggtgttccatgcgctcaagaagatcctgggcgaccgcggcatcagcacg
gccgtcggcgacgaaggcggtttcgcacccagcgtcgaaagccatgaagcggccatccag
ctgatcctcgaagccatcgacaaggccggcttcgtggcgggcgagcagattgcgctgggc
ctggactgcgccgcgagcgagttctacaaggacggcaactacgtgctctcgggcgagaac
ctcacgctgtcggccggcaactgggccgacatgctggccacctgggtcgacaagtacccg
atcatcagcatcgaggacggcatgcacgaaggcgactgggacggctggaagctgctcacc
gagcgcctgggcaagcgcgtgcagctggtgggcgacgacctgttcgtcaccaacaccaag
atcctgcaggaaggcatcgacaagggcattgccaactcgatcctgatcaagatcaaccag
atcggcacgctgaccgagaccttcgccgccatcgagatggccaagcgcgcgggctacacg
gccgtcatctcgcaccgctcgggcgaaaccgaggacagcaccatcgccgacatcgcggtg
ggcaccaacgcgggccagatcaagaccggctcgctctcgcgctcggaccgcatcgccaag
tacaaccagctgctgcgcatcgaggaagacctcggcgacatcgccagctaccccggccgc
ggcgcgttctacaacctgaagtag

DBGET integrated database retrieval system