KEGG   Variovorax paradoxus S110: Vapar_3446Help
Entry
Vapar_3446        CDS       T00916                                 

Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00010  Glycolysis / Gluconeogenesis
vap00680  Methane metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
vap01230  Biosynthesis of amino acids
vap03018  RNA degradation
Module
vap_M00002  Glycolysis, core module involving three-carbon compounds
vap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_3446
  Energy metabolism
   00680 Methane metabolism
    Vapar_3446
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Vapar_3446
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Vapar_3446
Messenger RNA biogenesis [BR:vap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Vapar_3446
Exosome [BR:vap04147]
 Exosomal proteins
  Proteins found in most exosomes
   Vapar_3446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MAAL_C MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: ACS20063
JGI: Vapar_3446
UniProt: C5CSV6
Position
1:3632345..3633628
Genome map
AA seq 427 aa AA seqDB search
MSAIVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKKRYL
GKGVLKAVENINTEISESVLGLDASEQAFLDRTMIDLDGTDNKGRLGANATLAVSMAVAR
AAAEESGLPLYRYFGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVR
YGAEVFHALKKILGDRGISTAVGDEGGFAPSVESHEAAIQLILEAIDKAGFVAGEQIALG
LDCAASEFYKDGNYVLSGENLTLSAGNWADMLATWVDKYPIISIEDGMHEGDWDGWKLLT
ERLGKRVQLVGDDLFVTNTKILQEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGYT
AVISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIASYPGR
GAFYNLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaatcgtagacatcgtcggccgtgaaatcctcgacagccgcggcaatcccacc
gtcgagtgcgacgttctgctcgaatcgggcaccatgggccgcgcggccgtgccctcgggc
gcatcgaccggttcgcgcgaagccatcgagctgcgcgacggcgacaagaagcgctacctc
ggcaagggcgtgctcaaggcggtggagaacatcaacaccgagatctcggaatccgtgctc
ggcctggacgccagcgagcaggccttcctcgaccgcacgatgatcgacctggacggcacc
gacaacaagggccgcctgggcgccaacgccaccctcgccgtctcgatggcggtggcacgc
gccgcggccgaggagtcgggcctgccgctgtaccgctacttcggcggcatgggcggcatg
cagctgccggtgccgatgatgaacgtcatcaacggcggcgcgcacgccaacaacagcctg
gacctgcaggagttcatgatcatccccgtgggcgcgccgagcttccgcgaagccgtgcgc
tacggcgccgaggtgttccatgcgctcaagaagatcctgggcgaccgcggcatcagcacg
gccgtcggcgacgaaggcggtttcgcacccagcgtcgaaagccatgaagcggccatccag
ctgatcctcgaagccatcgacaaggccggcttcgtggcgggcgagcagattgcgctgggc
ctggactgcgccgcgagcgagttctacaaggacggcaactacgtgctctcgggcgagaac
ctcacgctgtcggccggcaactgggccgacatgctggccacctgggtcgacaagtacccg
atcatcagcatcgaggacggcatgcacgaaggcgactgggacggctggaagctgctcacc
gagcgcctgggcaagcgcgtgcagctggtgggcgacgacctgttcgtcaccaacaccaag
atcctgcaggaaggcatcgacaagggcattgccaactcgatcctgatcaagatcaaccag
atcggcacgctgaccgagaccttcgccgccatcgagatggccaagcgcgcgggctacacg
gccgtcatctcgcaccgctcgggcgaaaccgaggacagcaccatcgccgacatcgcggtg
ggcaccaacgcgggccagatcaagaccggctcgctctcgcgctcggaccgcatcgccaag
tacaaccagctgctgcgcatcgaggaagacctcggcgacatcgccagctaccccggccgc
ggcgcgttctacaacctgaagtag

DBGET integrated database retrieval system