KEGG   Variovorax paradoxus S110: Vapar_3512Help
Entry
Vapar_3512        CDS       T00916                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_3512 (tpiA)
   01230 Biosynthesis of amino acids
    Vapar_3512 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_3512 (tpiA)
   00051 Fructose and mannose metabolism
    Vapar_3512 (tpiA)
   00562 Inositol phosphate metabolism
    Vapar_3512 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Vapar_3512 (tpiA)
Enzymes [BR:vap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Vapar_3512 (tpiA)
Exosome [BR:vap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Vapar_3512 (tpiA)
  Exosomal proteins of bladder cancer cells
   Vapar_3512 (tpiA)
  Exosomal proteins of melanoma cells
   Vapar_3512 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3701910..3702695)
Genome map
AA seq 261 aa AA seqDB search
MVTDNNTMTTKKKLIAGNWKMNGSLAANEALVKALQQGLAAAPANCGIALCAPAPYFAQL
QSLLAGSSAMALGAQDISAHPQGAFTGEHSATMLKDFGVRYAIVGHSERRQYHGETDEAV
AAKAAAALANGITPIVCVGETLAEREAGRTEEVVKRQLAAVIHVNGHCISEIVVAYEPVW
AIGTGKTATPEQAQAVHAVLRAQLHHAASEHAAGICILYGGSMNAANAAQLLAQPDIDGG
LIGGASLKAPDFLQIISAASR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggacaacaacacgatgaccacgaaaaagaagctgatcgcgggcaactggaag
atgaacggcagcctggctgccaacgaggcgctggtgaaggccctgcagcagggcctggcc
gcggcgccggccaactgcggcatcgcgctttgcgcgccggccccgtatttcgcgcagctg
caatcgctgctggcgggctcctcggccatggcgctgggggcacaggacatctcggcgcat
ccgcagggtgcgttcacgggcgagcattcggccaccatgctgaaggatttcggcgtgcgc
tatgccatcgtcggtcattcggagcgccgccaataccatggcgagaccgatgaggcggtg
gcggccaaggcggcggctgcgctcgcgaacggcatcacgccgatcgtctgcgtgggcgag
acgctggccgaacgcgaagcagggcgcaccgaagaagtcgtcaagcgccagctggccgcg
gtgatccacgtcaatggccattgcatcagcgagatcgtcgtggcctacgagccggtctgg
gccatcggcaccggcaagacggccacgccggaacaggcgcaggcggtgcatgccgtgctg
cgcgcacagctgcaccatgccgcgagcgagcacgccgccggcatctgcattctttatggc
ggcagcatgaacgcggccaacgccgcgcagctcctggcgcagcccgacatcgacggaggc
ctgatcggcggcgcgtcgctcaaggcccccgactttttgcagatcatttccgccgcttcc
cgctga

DBGET integrated database retrieval system