KEGG   Variovorax paradoxus S110: Vapar_3582Help
Entry
Vapar_3582        CDS       T00916                                 

Definition
Di-heme cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Vapar_3582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3784697..3786127
Genome map
AA seq 476 aa AA seqDB search
MRLRRSGPKGPAAAARAGRLALAALGAGALLVACGGSNGSGSAAVPPGAVAAAAAAGAAA
TPPALSSTLSLAAQVGQKMFFDKNLSGSGAMSCASCHDPAHAHAPANGLSVQLGGPHMDR
AGLRAVPSLRYKDVTPPYADLLDNPDGVSVPGPGGGLAWDGRADTLAAQARIPLLDPLEM
ANASSADVVKKLQAADYAPLIAKAFGAKAFDDSDAAFANALQALQAYQLEDKSFHPYSSK
FDLYAGNKIGGALTPAEGRGLKVFTNPNTGNCASCHYQGAGLGGSSALFTDFSYEAIGVP
RNAGIPANGNLQYFDMGVCGPMRTDHAPAAPSAANGFCGMFKAPTLRNVATRTAFFHNGV
MHSLEQVVRFYNTRDTQPELWYPTVGGTPKAKNDPGFPAYGLVTTQYTGGKVQKYDDLPA
AYASNIDTQLPMDGRAAGSAPPMSEQDMGDLVCFLHTLSDADTQPAAPAKPGACAN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcgccgttcaggcccgaaagggccggcggcggcggcgcgcgcgggtcggctc
gcgctggcggcgctcggcgcgggcgcgttgctggttgcatgcggcggcagcaacggcagc
ggctctgccgccgtgccgccgggtgcggttgcggccgccgcggctgccggtgccgcagcg
acgccgcccgcgctctccagcacgctgagccttgcagcgcaggtgggccagaagatgttc
ttcgacaagaacctctcgggctccggcgccatgtcctgcgcaagctgccacgacccggcg
catgcgcacgcgccggccaacggtctttcggtgcagctcggcggcccgcacatggaccgg
gccggcctgcgcgccgtgccctcgctgcgctacaaggacgtgaccccgccctacgccgac
ctgctggacaaccccgacggcgtcagcgtgccgggccctggcggcgggctggcctgggac
ggccgcgccgacacgctggccgcccaggcccgcatcccgctgctcgacccgctcgagatg
gccaacgccagcagcgccgacgtggtgaagaagctccaggccgccgactacgccccgctc
attgccaaggccttcggtgccaaggccttcgacgacagcgacgcggccttcgccaatgcc
ctgcaggccttgcaggcctaccagctcgaggacaagagctttcatccgtacagcagcaag
ttcgacctgtacgcgggcaacaagatcggcggtgcgctcacgcccgccgaagggcgcggc
ctcaaggtgttcaccaatccgaacaccggcaactgcgcctcgtgccactaccagggcgcg
ggcctcggcggcagctccgcgctgttcaccgacttctcctacgaggccatcggcgtgccg
cgcaacgccggcattcccgccaacggcaacctgcagtatttcgacatgggcgtgtgcggc
ccgatgcgcaccgaccacgcgccggccgcgcccagtgccgcgaacggcttctgcggcatg
ttcaaggcgccgacgctgcgcaacgtggcaacgcgcacggccttcttccacaacggcgtg
atgcattcgctggaacaggtcgtccgcttctacaacacgcgcgacacgcagcccgagctc
tggtatcccaccgtgggcggcacgccgaaggcgaagaacgaccccggctttccggcctac
ggcctcgtcaccacccagtacacgggcggcaaggtgcaaaagtacgacgacctgccggct
gcctacgcatcgaacatcgacacgcaactgccgatggacggccgcgccgcgggctcggcg
ccccccatgtccgagcaggacatgggcgacctggtctgcttcctccacaccctgagcgac
gcggacacccaacccgcggcgcccgcgaagcccggtgcctgcgccaactga

DBGET integrated database retrieval system