KEGG   Variovorax paradoxus S110: Vapar_3721Help
Entry
Vapar_3721        CDS       T00916                                 

Definition
type 11 methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Vapar_3721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3919509..3920186
Genome map
AA seq 225 aa AA seqDB search
MNPTPSLERLRFNMIEQQIRPWDVLDLEILDLLAAIRREDYVPPAHRALAFFDMELPLGD
GSVPGQVMLSPKVEARMLQDLHVQKHESVLEIGTGSGFMAALLAHRAAQVLSLEIDPALA
ARAAETLRQNGVANVEVRNADGAVPLPSGPSFDVIVLSGSVARIPQNLLGSLKVGGRLAA
IVGEEPMMRAHFVTRSSESKWDTIQPWDTVAPRLLNFPEPSRFSF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccaccccctccctcgagcgcctgcgcttcaacatgatcgaacagcagatccgg
ccctgggatgtgctcgatctggaaatcctcgacctgctggccgccatccggcgcgaagac
tacgtgccgcccgcgcaccgcgcgctggccttcttcgacatggaactcccgctgggcgac
ggctcggttcccggccaggtgatgctctcgcccaaggtcgaggcgcgcatgctgcaggac
ctgcatgtgcaaaagcacgaatcggtgctcgagatcggcacgggttcgggtttcatggcc
gccctgctcgcccatcgcgcggcccaggtgctgtcgctcgagatcgatcccgcgctggcc
gcccgcgccgccgagacgctgcgccagaacggcgtggccaatgtcgaggtgcgcaatgcc
gacggcgccgtgccgctgccgagcggcccgagcttcgacgtgatcgtgctcagcggctcg
gtggcgcgcattccgcagaacctgctcggctcgctcaaggtgggcggccgccttgccgcc
atcgtgggcgaggagccgatgatgcgcgcccacttcgtcacccgcagcagcgaaagcaag
tgggacaccatccagccctgggacaccgtggcgccgcggctgctcaatttccccgagccc
tcgcgcttctcgttctga

DBGET integrated database retrieval system