KEGG   Variovorax paradoxus S110: Vapar_3939Help
Entry
Vapar_3939        CDS       T00916                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Vapar_3939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4178674..4179732
Genome map
AA seq 352 aa AA seqDB search
MEKTKALRSAFVTGATGLLGNNLVRELVARGVSVKALVRSKAKGQQQFAGVKGVELVLGD
MADAPAFAGALQGCDVVFHTAAFFRDNFKGGSHWQELKRINVDGTRQLIEQAYGAGIRRF
VQTSSIAVLNGEPGVPMDETCLRELADAGDDYYRSKIMADQVVSAFLGTHPDMHASFVLP
GWMWGPADIGPTSSGQFVNDVVLGKLPGLVPGSFSVVDARDVARAQISAAEHGQRGERYL
AAGRHMTMQELVPLVGKIAGIKTPTRHLPFPLLYLLAAVQELYARTTGKPILLSLATVRL
MRKEAGRSHFNHTKSEQKLQLKFRPVEQTVADTLAWYRGNGWLPGVPARTES
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaccaaggccttgaggtccgcgttcgtcaccggcgcgaccggccttctcggc
aacaacctggtgcgcgaactggtcgcgcgcggcgtctcggtcaaggcccttgtccgctcg
aaggccaagggccagcagcagtttgcgggcgtgaagggcgtcgaactggtgctgggcgac
atggccgatgcgcccgccttcgccggcgcgctgcaaggctgcgacgtggtgttccacacc
gccgcgttcttccgggacaacttcaagggcggcagccactggcaagagctcaagcgcatc
aatgtggacggcacgcggcagctcatcgagcaggcctacggtgcgggcatccggcgcttc
gtccagacctcgtccatcgcggtgctcaacggcgagccgggcgtgcccatggacgagacc
tgcctgcgcgagctggccgacgccggcgacgactactaccgcagcaagatcatggccgac
caggtcgtgtcggcctttctgggcacgcacccggacatgcatgcgagcttcgtcctgccc
ggatggatgtggggaccggccgatatcggccccacctcgtcaggacaattcgtcaatgac
gtggtgctcggaaaactgcccgggctggtgcccggcagtttttccgtcgtcgacgcccgc
gatgtggccagggcgcagatctcggccgcggagcacgggcagcgcggcgaacgctacctg
gcggccggccgccacatgacgatgcaggaactggttcccctggtgggaaagatcgcaggc
atcaagacgccgacgcgccatttgccctttccgctcctgtatctgctggcggcggtgcag
gagctctacgcgcggaccaccggcaagcccatcctgctcagcctggccaccgtgcggctg
atgcgcaaggaggcggggcgcagccatttcaatcacacgaagagcgagcagaagcttcag
ctgaagtttcgcccggtcgagcagaccgttgccgacacgctcgcctggtatcgcggcaat
ggctggctgcccggtgtgccggcccgaaccgaatcctga

DBGET integrated database retrieval system