KEGG   Variovorax paradoxus S110: Vapar_4103Help
Entry
Vapar_4103        CDS       T00916                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_4103
   01230 Biosynthesis of amino acids
    Vapar_4103
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_4103
  Energy metabolism
   00680 Methane metabolism
    Vapar_4103
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_4103
Enzymes [BR:vap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Vapar_4103
Exosome [BR:vap04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Vapar_4103
  Exosomal proteins of melanoma cells
   Vapar_4103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4345180..4345923
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTETGIEQAKQAGRLLKAEGYDFDVAYTSVLKR
ATRTLWHTLDELDRTWLPVVHSWRLNERHYGALQGLNKAETAKKYGDEQVLVWRRSYGTP
PPPLEADDPRSERSDVRYAKLSPEQVPLTECLKDTVARVLPFWNESMAPAIRTGRRLVVA
AHGNSIRALVKYLDGISDDAIVGLNIPNGIPLVYELDDELKPLRHYYLGDAAAAEKAAAA
VASQGKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactggtactgatccgccacggcgaatcgacctggaatctcgaaaaccgcttc
accggctggaccgatgtcgacctgaccgaaaccggcatcgagcaggccaagcaggccggc
cggctgctcaaggccgagggctacgacttcgacgtcgcctacaccagcgtgctcaagcgc
gccacccgcacgctctggcacacgctggacgaactcgaccgcacctggctgcccgtggtg
cattcgtggcgcctgaacgagcgccactacggcgccctgcagggcctcaacaaggccgaa
accgccaagaagtacggcgacgagcaggtgctggtctggcgccgcagctacggcaccccg
ccgccgccgctggaagccgacgacccgcgcagcgagcgctccgacgtgcgctacgccaag
ctttcgcccgaacaggtcccgctgaccgaatgcctgaaggacacggtggcacgcgtgctg
ccgttctggaacgaatcgatggcgccggccatccgcaccgggcgccgcctggtggtggcg
gcgcacggcaactcgatccgcgcgctggtcaagtacctcgacggcatctcggacgacgcc
atcgtcgggctgaacatcccgaacggcattccgctggtctacgagctcgacgacgagctc
aagccgctgcggcactactacctcggcgacgccgcggccgccgaaaaggccgccgcagcg
gtggcctcgcagggcaagggctga

DBGET integrated database retrieval system