KEGG   Variovorax paradoxus S110: Vapar_4119Help
Entry
Vapar_4119        CDS       T00916                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00790  Folate biosynthesis
vap01100  Metabolic pathways
Module
vap_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Vapar_4119
Enzymes [BR:vap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Vapar_4119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI PL48
Motif
Other DBs
NCBI-ProteinID: ACS20732
JGI: Vapar_4119
UniProt: C5CWX5
Position
1:complement(4358181..4358912)
Genome map
AA seq 243 aa AA seqDB search
MLRKTDVEPRPDGNNDDEGTPVSVKIRERLTAARRRFNANDNIAEFIEPGELESLLDEVE
VKMKGVLESLVIDLENDHNTGNTARRVAKMYLNEVFKGRYVAPPSLTEFPNAEHLNELMI
VGPITVRSACSHHFCPIIGKLWIGIMPNEHTNVIGLSKYARLAEWVMGRPQIQEEAVVQL
ADLIQEKTQPDGLALVMEAEHFCMAWRGVKEMDSKMINSVMRGVFLKDPSLRREFLSLLP
RRS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggaaaaccgacgtggaaccgcgccctgacggcaacaacgacgacgagggcacc
cccgtctcggtgaagatccgcgagcgcctgaccgccgcgcgcaggcgcttcaatgccaac
gacaacatcgccgagttcatcgagccgggcgagctcgaatcgctgctcgacgaggtcgag
gtcaagatgaagggcgtgctcgagagcctggtgatcgacctcgagaacgaccacaacacc
ggcaacaccgcgcgccgcgtggccaagatgtacctgaacgaagtgttcaagggccgctac
gtggcgccaccctcgctcaccgaattcccgaacgccgagcacctgaacgagctgatgatc
gtcggcccgatcaccgtgcgcagcgcctgctcgcaccacttctgcccgatcatcggcaag
ctgtggatcggcatcatgcccaacgagcacaccaatgtcatcggcctgtcgaagtacgcg
cgcctggccgaatgggtcatgggccgcccgcagatccaggaagaagcggtggtgcagctg
gccgacctgatccaggaaaagacgcagcccgacggcctcgcgctcgtgatggaagccgag
catttctgcatggcctggcgcggcgtgaaggaaatggacagcaagatgatcaactccgtg
atgcgcggcgtgttcctgaaggacccgagcctgcggcgcgaattcctttccctcttgcca
agaaggagctga

DBGET integrated database retrieval system