KEGG   Variovorax paradoxus S110: Vapar_4215Help
Entry
Vapar_4215        CDS       T00916                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00330  Arginine and proline metabolism
vap00332  Carbapenem biosynthesis
vap01100  Metabolic pathways
vap01130  Biosynthesis of antibiotics
vap01230  Biosynthesis of amino acids
Module
vap_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Vapar_4215
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Vapar_4215
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Vapar_4215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACS20828
JGI: Vapar_4215
UniProt: C5CXX2
Position
1:complement(4455633..4456772)
Genome map
AA seq 379 aa AA seqDB search
MTSNSGSTALRDARRIVVKVGSSLVTNEGRGLDEAAIGEWCRQLAVLVQGGREVVMVSSG
AIAEGMKRLGWRTRPHEVHELQAAAAVGQMGLAQMYETKLRENRIGSAQVLLTHADLADR
ERYLNARSTLVTLLGLGVVPVINENDTVVNDEIKFGDNDTLGALVANLVEADALVILTDQ
KGLYTADPRKDPQAKFVHEAAAGDPALEAMAGGAGSSLGRGGMITKILAAKRAAGSGAST
VIAWGREPDALLRLVRGESIGTLLVAQTAKHQARKRWMADHLQLRGAVTVDAGAAAKVRA
EGKSLLPIGMTGVSGEFSRGDVIAVRDADGVELARGLANYSSVEARLLCRKPSSEFERLL
GYVAEPEMVHRDNMVLMRG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaactccggatccactgccttgcgggatgcccgccgtatcgtcgtcaaggta
ggctccagcctcgtgaccaacgaggggcgcggtctcgacgaggccgccatcggcgaatgg
tgccggcagctggcggtgctggtgcagggcggccgcgaggtggtcatggtgtccagcggc
gccattgccgaaggcatgaagcgcctgggctggcgcacgcggccgcacgaggtgcatgaa
ctgcaggccgccgcggccgtcgggcagatgggcctggcccagatgtacgagaccaagctg
cgcgagaaccggatcggcagcgcccaggtgctgctgacccatgccgacctggccgaccgc
gagcgttacctcaatgcgcgctcgacgctcgtcacgctgctcgggctgggcgtggtgccg
gtcatcaacgagaacgacaccgtcgtcaacgacgagatcaagttcggcgacaacgacacg
ctcggcgcgctcgtggccaacctggtcgaagccgatgcgctggtgatcctcacggaccag
aagggcctctacacggccgatccgcgcaaggacccgcaggccaagttcgtgcacgaggcc
gcggccggcgacccggcgctcgaagccatggcgggcggggcgggctccagcctcggccgc
ggcggcatgatcaccaagatcctcgctgccaagcgcgcggccggctcgggcgcctccacc
gtgatcgcctggggccgcgagcccgatgccctgctgcgcctcgtgcgcggcgaatccatc
ggcacgctgctggtggcgcagacggccaagcaccaggcgcgcaagcgctggatggccgac
cacctgcagctgcgcggcgcggtcaccgtcgatgccggcgcggccgccaaggtgcgcgcc
gagggcaagagcctgctgccgatcggcatgacgggcgtctcgggcgagttttcgcgcggc
gacgtgatcgccgtgcgcgacgccgacggcgtggaactggcccgcggcctggccaactac
tcgagcgtggaggcccggcttttgtgccgcaagccctcgtcggaattcgagcggctgctg
ggctatgtggcggagccggaaatggtccaccgcgacaacatggtgctgatgcgcggctga

DBGET integrated database retrieval system