KEGG   Variovorax paradoxus S110: Vapar_4235Help
Entry
Vapar_4235        CDS       T00916                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vapar_4235
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_4235
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Vapar_4235
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Vapar_4235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4477169..4478368)
Genome map
AA seq 399 aa AA seqDB search
MPAPVIHFKLASASEPSGTARPRPPRPLKNPRLQGFRCLRCDAPYPLTLANDGCPACRGM
GVHVGLHASYLPGGDSPVPMPYAPGFTLGEGGTPLLDMPELAHEFGVARLALKDESCNPT
GSHKDRMTAVGVAQALDFGAHTLVLASSGNAAVSAAHYAWAAGLGCEVATYEGLPAAYAR
QLDALGARRHAFADNAGRWAFVRERSQHPGYFALTNYRLPALGSAPLAIEGYKPIALECL
AEGGLPDHLVIPTARGDLAWGIYAGFRDLLAAGRISRLPRLWLVEPFARLSRVLAGGALD
GAYPGHTAQFSTAGSTVTFLQWQAAVASGGGAVVVGDEQARAARQKLTAAGVSAELCAAA
GLDALRQLREGNAIAADAHVVLMLTANASRDPSWPDRAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcccgtcatccacttcaagctcgcctcggcttccgagccgtccggcaccgcg
cgaccccgtccgccgcgcccgctgaaaaacccccgcctgcagggttttcggtgcctgcgc
tgcgatgccccctatccgctgacgctggcgaacgacggctgcccggcctgccgcggcatg
ggcgtccatgtcgggctgcacgcgagctacctgccgggcggcgacagccccgtgcccatg
ccctacgcgccgggcttcacgctgggcgagggcggcacgccgctgctcgacatgccggaa
ttggcgcacgaattcggcgtggcgcggctcgcgctcaaggacgaatcgtgcaaccccacg
ggctcccacaaggaccgcatgaccgcggtgggcgtggcccaggcgctggacttcggcgcc
cacacgctggtgctggcctcatcgggcaatgccgcggtctcggcggcgcactatgcatgg
gctgcggggctgggctgcgaagtggccacttacgaaggcctgcccgccgcctacgcgcgg
cagctcgatgcgctgggcgcgcggcgccacgcctttgccgacaacgccggccgctgggcc
ttcgtgcgcgagcgctcgcagcatccgggctatttcgcgctgaccaattaccgcctgccc
gccctgggcagcgcgccgctcgcgatcgagggctacaagcccatcgccctggagtgcctg
gccgagggcggcctgcccgaccacctcgtgattcccacggcgcgcggcgacctggcctgg
ggcatctacgcgggctttcgagacctgctggccgccgggcgcatttcgcggctgccgcgg
ctctggctggtggagccttttgcgcgcctctcgcgcgtgctggccggcggggcgctcgac
ggcgcatatcccggccacaccgcgcagttttccaccgccggctccaccgtgaccttcctg
cagtggcaggcggccgtcgcctcgggcggcggcgcggtggtggtgggcgacgagcaggcc
cgcgcggcccggcaaaagctcacggcggccggcgtgagcgccgaactgtgcgcggcggcc
gggctcgacgcgctgcgccagctgcgcgagggcaacgcgattgccgccgacgcccacgtg
gtgctgatgctcaccgccaacgcctcgcgcgacccgagctggcccgaccgggccgcctga

DBGET integrated database retrieval system