KEGG   Variovorax paradoxus S110: Vapar_4329Help
Entry
Vapar_4329        CDS       T00916                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00230  Purine metabolism
vap01100  Metabolic pathways
Module
vap_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Vapar_4329
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Vapar_4329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 ABC_tran RsgA_GTPase AAA_16 AAA_22 MMR_HSR1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACS20940
JGI: Vapar_4329
UniProt: C5CYX9
Position
1:4573965..4574585
Genome map
AA seq 206 aa AA seqDB search
MDYPGNIFVVAAPSGAGKSSLVKALMELDTAVQPSVSHTTRPPRGQEKHGREYFFTSPSE
FDAMIAADGFVEWAHVHGHRYGTSKKAIEERIAQGADVILEIDFQGAIQIRKTFANAVMI
FILPPSWEELRSRLERRGEDSAAVIELRLKNAAEEMARAGEFDFVIINELFERALFDLKA
IVHAQRLRYSAQRRARADTFAALNIP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggactatccaggcaacatctttgtcgtggcggcacccagcggtgccggcaaatcgagc
ctggtcaaggcgctcatggagctggacacggccgtccagccctcggtttcccacaccacc
cggccaccgcgcgggcaggaaaagcacggccgggagtatttctttacctcgccctccgaa
ttcgacgccatgatcgcggcggatgggttcgtggagtgggcccacgtgcacgggcaccgc
tacggcacctccaagaaagccatcgaggagcgcatcgcccagggggccgacgtcatcctg
gaaatcgacttccagggcgccatccagatccgcaagaccttcgccaacgccgtgatgatc
ttcatcctgccgcccagttgggaagaactgcgctcccggctggagcggcgcggcgaagac
agcgcggccgtcatcgagctgcgcctcaagaatgccgccgaagaaatggcccgggcaggg
gaattcgacttcgttataatcaacgagttatttgagcgcgcgcttttcgatctcaaggcg
atcgtccacgctcagcggcttcggtattctgcacagcgccgcgcacgtgccgacacattc
gccgccctgaacatcccctga

DBGET integrated database retrieval system