KEGG   Variovorax paradoxus S110: Vapar_4344Help
Entry
Vapar_4344        CDS       T00916                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vap  Variovorax paradoxus S110
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:vap00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4590903..4591793
Genome map
AA seq 296 aa AA seqDB search
MKAIYDLPAPAKLNLFLHITGRREDGYHLLQSVFMLIDWCDTLHVELRSDGQLSREDLTT
ELPPDDLVLRAARALQAHAAPGQGAHIGIAKQVPAQAGMGGGSSDAATCLLALNRLWGLD
LPLSRLAEIGVQLGADVPFFLGGRNAWVEGIGEKIRPVDIPSARFVVAKPPQGLDTKLIF
SAPDLQRATPVAIISGFAADSEQLEAPNPESSAFKVFDFGHNDLQPVAQRLCPAVTDAIE
WLGAQGLKARMTGSGSSVFAKMPQGPQEAELAKAPPGWQVRQCSNLAVHPLWGWAT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgatctacgaccttcccgcaccggccaagctcaacctcttcctgcacatcacc
ggccggcgcgaagacggctaccacctgctgcagtcggtcttcatgctgatcgactggtgc
gacacgctgcacgtcgaactgcgcagcgacggccagctcagccgcgaagacctcacgacc
gaactgccgcccgacgacctcgtgctgcgcgcggcgcgggcgctgcaggcgcatgcggcg
cccggccagggcgcccacatcggcatcgccaagcaggtgccggcgcaggccggcatgggc
ggcggctcctcggacgccgccacctgcctcctggcgctgaaccgcctgtgggggctggac
ctgccgctctcgcgcctggccgagatcggcgtgcaactcggcgccgacgtgccgttcttc
ctgggcgggcgcaatgcctgggtcgagggaatcggcgagaaaatcaggcccgtggacatc
ccttccgcacggttcgtggtggccaagccaccccagggactcgacaccaagctaattttt
tctgcgcccgaccttcaacgcgccactcctgttgctataatctcgggctttgctgcagat
agcgaacagcttgaagccccaaaccccgaaagcagcgctttcaaggttttcgacttcggc
cacaacgacctgcagccggttgcccagcggctttgccccgcggtcaccgacgccatcgaa
tggctcggcgcccaaggattgaaagcccggatgaccggctccggaagttcggttttcgcg
aagatgccgcaagggccgcaggaagcggaactggcaaaagccccaccgggctggcaggtt
cgccaatgcagcaacctggccgttcatccactttggggatgggcgacctga

DBGET integrated database retrieval system