KEGG   Variovorax paradoxus S110: Vapar_4592Help
Entry
Vapar_4592        CDS       T00916                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Vapar_4592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4863016..4866009)
Genome map
AA seq 997 aa AA seqDB search
MKLHFEPNLDYQLQAIEAVCDLFRGQEACRTEFTVTMKLPDQQLTLGVAETDLGVGNRLT
LLDDQLLQNLRDVQLRGGLAPSSMLASGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKF
VIVVPSVAIKEGVYKSLQITEEHFKGIYAGVPVDFFLYDSGKLGQVRNFATSSTIQVMVV
TVGAINKKDVNNLYKDSEKTGGEKPIDLIKATRPIVIVDEPQSVDGGLTGAGKTALDAMN
PLCTLRYSATHANKHHMVFRLDALDAYERKLVKQIEVAAATIEDAYNKAFVRLVSVTNKR
GAISAKVELHVKTASGVKPQEVTVGDGDDLQQSTKRAVYADFRVGEINTAKGEEFLELRY
PGGEVMLAVGQAYGDVDALAVQREMIRRTIREHLEKEKLLGPKGIKVLSLFFIDAVERYR
QYDTEGNPVKGDYARIFEEEYRRAAKLPAYQSLFAEIDLASAAEEVHNGYFSIDKKGGWS
DTAENNAGNRENAERAYILIMKEKEKLLDIKTPLKFIFSHSALKEGWDNPNVFQICTLRE
IGTERERRQTIGRGLRLCVDQHGERVRGFEVNRLTVIATESYEQFAENLQKEIEADTGIR
FGILERHQFAAIAIKAADGTLAPLGVDQSRALWDHLRAAGHLDAKGKVQDSLKVALKNGT
LALPPAFEAQRTQIAEVLRKVSGRLEIKNADDRRAVLLRKGADGKAVYLSEDFKALWDRI
KHRTTYRVQFDNAKLLQDCTTELKKAPAIAKARLQWRKADIAIGKAGVQATEKEGAATIV
LDETDIELPDLLTDLQDRTQLTRRSIVTILTESGRLNEFRRNPQQFIEQTTEVINRCKRL
ALVDGIKYQKMGDDHFYAQELFAQDELTGYLRNMLLDTGRSIYEHVIYDSDTERGFADAL
EKNDGVVLYAKLPSWFKVPTPLGPYNPDWAILFDQDGTQRLYFVVETKSSLFADDLRDKE
SAKIECGRAHFAALGVGENPAKYLVATSLGDVLKTMA
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcacttcgagcccaatctggactaccagcttcaagccatcgaggcggtctgt
gacctgttccgtgggcaggaagcatgccgaaccgagttcacggtcaccatgaagctgccc
gaccagcaattgacgctgggcgtggccgagaccgaccttggcgttggcaatcggttgacg
ttgctggatgaccaactgctgcagaacctgcgcgacgttcaattgcgcggcggcctggcg
ccgtccagcatgctggcgtcgggtgatttcaccgtcgaaatggagacgggcaccggcaag
acctacgtctacctgcgcacgatcttcgagctgaacaaacgctacggcttcaccaagttc
gtcatcgtggtgccttcggtggccatcaaagaaggcgtctacaagtcgctgcagatcacc
gaagagcactttaagggcatctatgccggggtgccggtggacttcttcctgtacgactcg
ggcaagctgggccaagtgcgcaacttcgccaccagttcgaccatccaggtcatggtggtc
acggtcggcgccatcaacaagaaggatgtcaacaacctctataaagacagcgagaagacg
ggcggcgagaagcccattgacctgatcaaggcgacacggcccattgtcatcgtggacgag
ccgcagagcgtggacggtggcctgaccggcgccggcaagaccgcgctggacgccatgaat
ccgctgtgcacgttgcgctattcggccacgcacgccaacaagcaccacatggtgttcagg
ctcgatgcgctggacgcctacgaacgcaaactggtcaagcagatcgaggtggcggcggcc
accatcgaggacgcgtacaacaaggccttcgtgcggctggtgtcggtaaccaacaagcgc
ggcgccatcagcgccaaggtggagctgcatgtcaagaccgcgagcggtgtgaagccccaa
gaggtcactgtcggtgacggcgacgacttgcagcaaagtaccaagcgcgcggtctacgcc
gactttcgtgtgggcgaaatcaacacggccaagggcgaagaattcctggagctgcgttat
cccggcggcgaggtcatgctcgccgtgggccaggcctacggcgatgtcgatgccctcgcc
gtgcagcgcgagatgatccggcgaaccatccgcgagcacctggagaaggaaaaacttctc
gggccgaagggcatcaaggtgctgtcgctgttcttcattgacgcggtggagcgctaccgc
cagtacgacacggagggcaacccggtaaagggcgactacgcccgcatcttcgaagaagag
tatcggcgcgcggccaagctgccggcctatcagagcctgttcgctgaaattgacctagcc
agtgccgccgaggaggtgcacaacggctacttctccatcgacaagaagggtggctggtcg
gacacggccgagaacaacgccggcaaccgcgagaacgccgagcgagcatacatcctgatc
atgaaggagaaggaaaagctgctggacatcaagacgccgctgaaattcatcttctcgcac
tcggcactgaaggagggctgggacaaccccaacgtcttccagatttgcaccttgcgggaa
atcggcaccgagcgcgagcgccggcagaccatcggccgtggtctgcgcctgtgcgtggat
cagcacggcgagcgcgtgcgcggcttcgaagtcaaccggctgacggtcatcgcgaccgag
tcctacgaacagttcgccgagaacttgcagaaggaaatcgaggctgacacgggcatccgc
ttcggaatcctggagcggcaccagttcgcggccatcgccatcaaggcggcggacggcacg
ctggcgccgctgggcgttgaccagtccagggccttgtgggatcacctaagagctgccggg
catctcgatgccaagggcaaggtgcaggactcgctgaaggtggccctgaaaaacggcacc
ctggcgttgccgccggcctttgaggcccagcgcacgcagattgccgaggtgctacgcaag
gtgtccggccggctcgaaatcaagaatgccgacgaccgccgtgcggtcctgctgcgcaag
ggggcggacgggaaggccgtgtacctgtccgaggacttcaaggcgctgtgggaccgcatc
aagcaccggaccacctaccgggtgcagttcgacaacgccaagctgctgcaagactgcacc
accgaactgaagaaggcgccggccatcgcgaaggcccggctgcagtggcgcaaggccgac
attgccatcggcaaggccggcgtgcaggccacggaaaaggaaggcgctgccaccatagta
ctggatgagaccgacatcgagcttccggacctcttgaccgacttgcaggatcgcacccag
ctcacccgtcgcagcatcgtcaccatcctgaccgaaagcggccggctgaatgagttcagg
cgcaacccgcagcagttcatcgagcagaccaccgaggtcatcaaccgctgcaagcgcctg
gcgctggtggacggcatcaaataccagaaaatgggcgatgaccatttctacgcccaagag
ctgttcgcccaggatgagctgaccggctatctgcgcaacatgctgctggacactggccgg
tcgatctacgagcacgtgatctacgactcggataccgaacgtggcttcgctgacgccctg
gagaaaaacgacggcgtggtgctctacgccaagctgcctagctggttcaaggtacccacg
ccgctgggcccatacaacccggactgggccatcctgttcgaccaggacggcacccagcgt
ctatatttcgtcgttgagacgaagagtagcctgttcgcagacgatctgcgcgacaaggaa
agtgccaagatcgaatgcggcagagcgcactttgcggcactcggtgtgggtgagaatcca
gcgaagtacctcgtcgccacatccttgggcgatgtactaaagactatggcgtag

DBGET integrated database retrieval system