KEGG   Variovorax paradoxus S110: Vapar_4614Help
Entry
Vapar_4614        CDS       T00916                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vap  Variovorax paradoxus S110
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vap00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:vap00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4900595..4901557)
Genome map
AA seq 320 aa AA seqDB search
MLYKRNPQLNKNGELIHLLSIEGLPKDIVTHILDTAANFTSVSDREVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAAKRLSADVINLDIARSSATKGESLLDTIANLSAMAADLFVVRHS
ESGAPYLIAQHVAPHVHVVNAGDGRHAHPTQGLLDMYTIRHYKKDFANLTVAIVGDVLHS
RVARSDIHALTTLGCAEVRVVGPKTLVPGDMAGMGVRVCHTLEEGIRDCDVIIMLRLQNE
RMSGALLPSSQEFFKTYGLTPEKLQLAKSDAIVMHPGPINRGVEIDSAVVDGKQSVILPQ
VTFGIAVRMAVMSIVAGNEA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaagcgaaacccgcaactcaacaagaacggcgagctgatccacctgctgtcg
atcgagggcctgcccaaggacatcgtcacgcacatcctcgacaccgccgccaacttcacg
agcgtgagcgaccgcgaggtgaagaaggtgccgctgctgcgcggcaagagcgtgttcaac
ctgttcttcgagaactcgacgcgcacccgcaccaccttcgagatcgcggccaagcgcctg
tcggccgacgtcatcaacctggacatcgcgcgctcctcggccaccaagggcgagtcgctg
ctcgacaccatcgccaacctgagcgcgatggcggccgacctgttcgtggtgcgccacagc
gagtcgggcgcgccctacctgatcgcgcagcatgtggcgccgcacgtgcacgtggtgaac
gccggcgacggccgccatgcgcacccgacgcaggggctgctcgacatgtacacgatccgc
cactacaagaaggattttgcgaacctcacggtggccatcgttggcgacgtgctgcactcg
cgcgtggcgcgctccgacatccatgcgctcaccacgctcggctgcgccgaggtgcgcgtg
gtcggccccaagacgctggtgcccggcgacatggccggcatgggcgtgcgcgtgtgccac
acgctcgaagagggcatcagggattgcgacgtgatcatcatgctgcgcctgcagaacgag
cgcatgagcggcgcgctgctgccctcgtcgcaggagttcttcaagacctacgggctcacg
cccgagaagctgcagctggcgaagtcggatgccatcgtgatgcatccgggccccatcaac
cgcggcgtggagatcgactctgccgtggtcgatggaaagcaaagcgtgatccttccccag
gtcaccttcggcatcgccgttcgaatggccgtcatgagcatcgtcgcaggtaacgaagca
tag

DBGET integrated database retrieval system