KEGG   Variovorax paradoxus S110: Vapar_4640Help
Entry
Vapar_4640        CDS       T00916                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vap  Variovorax paradoxus S110
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Vapar_4640
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Vapar_4640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4930854..4931771
Genome map
AA seq 305 aa AA seqDB search
MVLGSLNMDIVLRVPHAPAAGETLLGHSIAHIPGGKGANQAVSCAREGGRVGMIGCVGND
AHGQALRDALGRDGIDTTALRTSPSEPTGTALILVEDGGQNRIVMIPGANAQAEIDAPAL
RQQLQGAAFLVTQFEIPLDQVARAISVAHEAGCKVLLNPSPVQPIAEPLWPRIDTLVVNE
IEAQALCGQAADSPQEAALAGQALRAKGIARVVVTLGARGAVAIDADGARHHPAPQVQAV
DTTAAGDTFLGALAVALGEGQSFDEAVRLGIRAAALCIQQPGAQPSIPQRDAVLQSPLPP
DWIAL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggtgctcggcagcctgaacatggacatcgtgctgcgcgtgccgcatgcgccggccgcg
ggcgaaaccctgctgggccattcgatcgcccacattccgggcggcaagggcgccaaccag
gccgtgagctgcgcgcgcgaaggcggccgcgtcggcatgatcggctgcgtcggcaacgac
gcgcacggccaggcgctgcgcgatgcgctcgggcgcgacggcatcgacaccaccgcgctg
cgcaccagcccgagcgagcccacgggcaccgcgctgatcctggtggaagacggcggccag
aaccgcatcgtgatgattcccggcgccaacgcgcaggccgagatcgacgcgccggcgctg
cgccagcagctgcagggcgcggccttcctggtgacgcagttcgagataccgctggaccag
gtcgcgcgcgccatttcggtggcgcacgaggccggctgcaaggtgctgctcaacccgtcg
ccggtgcagccgatcgccgagccgctgtggccgcgcatcgacacgctggtcgtcaacgag
atcgaggcccaggcgctgtgcggccaggccgccgacagcccgcaggaagccgcgctggcc
ggccaggccctgcgcgccaagggcattgcgcgcgtggtcgtcacgctcggcgcgcgcggc
gccgtggccatcgatgccgatggcgcgcgccaccatcccgcgccccaggtccaggcggtc
gacaccacggccgcaggcgacaccttcctgggcgcgctggccgtggcgctgggcgagggc
cagtccttcgacgaagccgtgcgcctgggcattcgcgccgccgcgctgtgcatccagcag
cccggcgcccagccttccattccgcagcgcgatgccgtgctgcaaagccccctgccaccc
gactggatcgcactgtga

DBGET integrated database retrieval system