KEGG   Variovorax paradoxus S110: Vapar_4644Help
Entry
Vapar_4644        CDS       T00916                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Vapar_4644
Secretion system [BR:vap02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Vapar_4644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4934313..4935035
Genome map
AA seq 240 aa AA seqDB search
MKLARNLLLAACTLAAAATALAGEAEIRKNLPARIPQFPAIDEVTKSPLPGLYEVRVNGF
QIYYTDEQGNYLLQGNLIDVNARKNLTEERIEKLSQVSFDKLPMKDAIKIVRGSGKRKLA
VFEDPNCGYCKRFEKDMKTVDNVTVYLFLYPVLGPDSAVKSRDIWCSKDKGKAWGDWMET
SVKPATAATSCDVTALQRNVEFGRKYNITGTPTLIFSDGTRTPGAIPADQVEKQLAASIN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcacgcaaccttcttctcgccgcctgcacgctggctgcggccgccacggcc
ctggccggtgaggccgagatccgcaagaaccttccggcgcgcattccgcagttcccggcc
atcgacgaagtcaccaagtcgccgctgccgggcctctacgaagtgcgcgtgaacggcttc
cagatctactacaccgacgagcagggcaactacctgctgcagggcaacctgatcgacgtg
aatgcgcgcaagaacctgacagaggagcgcatcgagaagctcagccaggtctcgttcgac
aagctgcccatgaaagacgccatcaagatcgtgcgcggcagcggcaagcgcaagctggcg
gtgttcgaagacccgaactgcggctactgcaagcgcttcgagaaagacatgaagacggtc
gacaacgtcaccgtctacctgttcctctacccggtgctcggtcccgattcggccgtcaag
tcgcgcgacatctggtgcagcaaggacaagggcaaggcctggggcgactggatggaaacc
agcgtcaagcccgccaccgcggcaaccagctgcgacgtcacggccctgcagcgcaacgtg
gaattcgggcgcaagtacaacatcaccggcacgcccacgctgatcttcagcgacggcacc
cgcacgccgggcgccattcccgcggaccaggtcgagaagcaactcgccgcctccatcaac
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system