KEGG   Variovorax paradoxus S110: Vapar_4665Help
Entry
Vapar_4665        CDS       T00916                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vap  Variovorax paradoxus S110
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vap03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4956231..4956803)
Genome map
AA seq 190 aa AA seqDB search
MIGKLTGILAERNPPQVVVDCNGVGYEVDVPMSTFYNLPGTGERVSLLTHFVVREDAQIL
YGFGTAEERAAFRQLIKISGVGPRTALGLLSGMSVGELSQAITTQELGRLVKIPGIGKKT
AERLLLELKGKLGADIGLPAHAATDAQADILQALVALGYSDKEAALALKALPKDATVSEG
IKLALKALAK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaactcaccggcatcctggccgagcgcaacccaccgcaggtggtggtggac
tgcaacggcgtcggctacgaggtcgatgtgccgatgagcacgttctacaacctgcccggc
accggagagcgcgtttcgctgctcacgcacttcgtggtgcgcgaggacgcgcagattctc
tacggtttcggcaccgccgaggagcgtgcggcctttcggcaactcatcaagatcagcggc
gtgggcccgcgcaccgcgctcggcctgctgtcgggcatgagcgtgggcgagctgtcgcag
gcgatcaccacgcaggagctcggccggctcgtgaagatcccgggcatcggcaagaagacc
gccgagcggctgctgctcgaactcaagggcaagctgggcgccgacatcgggctgcccgcc
catgcggccaccgacgcgcaggccgacatcctgcaggcgctggtcgcgctgggctacagc
gacaaggaagccgcgctggcgctcaaggcactgccgaaggacgcgacggtgagcgagggg
atcaagctggcgttgaaggcattggcgaaataa

DBGET integrated database retrieval system