KEGG   Variovorax paradoxus S110: Vapar_4700Help
Entry
Vapar_4700        CDS       T00916                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vap  Variovorax paradoxus S110
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Vapar_4700
Enzymes [BR:vap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Vapar_4700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4990354..4991310
Genome map
AA seq 318 aa AA seqDB search
MPTATPNQPLGGNTMPRFAGPGTMMRLPSATSPEGLDAAFIGVPLDIGTSNRPGARFGPR
QIRAESALLRPYNMATGAAPFDRLNVADLGDVPINTYSLEKSIDIISDFYGAVLATGCAP
LTLGGDHTIALPILRAVARKHGPVALVHVDAHADVNDDMFGERIAHGTPFRRAVEEGLLA
CDKVWQIGLRGTGYAADDFDWPRQQGFTVVQAHEVWYQSLAPLMAQVRERIGPAHPVYIS
FDIDGIDPSFAGGTGTPEIGGLTVPQALEIVRGCRGLNVVGADLVEVSPPYDVSGNTALL
GANLLYEMLCVLPGVPYR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgccacaccgaaccagccgctcggcggcaacacgatgccgcgcttcgccggt
cccggcacgatgatgcggctgccgtccgcaacttcgcctgaggggctggacgcggccttc
atcggcgtgccactggacatcggcacctccaaccggccgggcgcgcgcttcgggccgcgc
cagatccgcgccgagtcggcattgctgcggccctacaacatggccaccggcgcggcgcct
ttcgaccggctgaacgtggccgacctgggcgacgtgccgatcaacacctattcgctcgaa
aaatcgatcgacatcatctcggacttctatggcgcggtgctggccaccggctgcgcgccg
ctgacgctcggcggcgaccacaccatcgcgttgccgatcctgcgcgcggtggcgcgcaag
catggcccggtcgcgctggtgcatgtggatgcgcatgcggacgtcaacgacgacatgttc
ggcgagcgcattgcccacggcacgccgttccggcgcgcggtcgaggaaggcctgctggcc
tgcgacaaggtctggcagatcggcctgcgcggcaccggctacgcggcggacgatttcgac
tggccgcgccagcagggcttcacggtggtgcaggcgcacgaggtctggtaccagtcgctg
gcgccgctgatggcgcaggtgcgcgagcgcatcgggccggcgcacccggtctacatcagc
ttcgacatcgacggcatcgacccttcgtttgccggcggtacgggcacgcccgagatcggc
gggctcaccgtgccacaggcgctggagatcgtgcgcggctgccggggcttgaacgtcgtc
ggggccgatctggtggaggtcagcccgccgtacgacgtcagcgggaacaccgcgctgctg
ggggccaatcttctgtatgagatgttgtgtgtgctgcctggggtgccttatcggtga

DBGET integrated database retrieval system