KEGG   Variovorax paradoxus S110: Vapar_4796Help
Entry
Vapar_4796        CDS       T00916                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
vap  Variovorax paradoxus S110
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Vapar_4796
  Amino acid metabolism
   00380 Tryptophan metabolism
    Vapar_4796
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Vapar_4796
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Vapar_4796
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Vapar_4796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:5111865..5115089
Genome map
AA seq 1074 aa AA seqDB search
MAGKNSLHPIPHPAKKPFVGNLLSIGSDSPVLDMWKIAQDLGGIYWLDMPGMPVIVVSSP
ALVDELCEEARFDKSTRGALRRLRAASHGLFTSDTHEETWSKPHNILLANFSQRAMQAYH
PMMLDIAGQLVTKWERLNFDEEVDVVRDMTALTLDTIGLCGFGYRFNSFYREGFHPFVDA
MVRTLETVQNRRGLPLEEFMLKKELAQQRKDIRFMHKMVEDIIEERRAGGADIATKPDLL
SYMIAGVDKKSGEKLTDKMIRDECIEFLIAGHETTSGLLSFAIYFLLKNPEALAKAQAEV
DNVFGPDTSQKPTYAQVNRLQYVMQVLKEALRLYPTAPAIAMRAKEDTTIGGQYTIKKKN
MVIMHALALHRDKGIWGEDADEFNPDHFSREAERERPVNAFKPFGNGQRACIGRQFALQE
AVLTLGMILQRFDLVDHTGYKLRIKEALTIKPEGLKIKALLRDPATRPRGNTADAAAAPV
QPRQAAARKPQAARHGTSLLVLQGSNLGTAEDLARQLAEAGELRGFSTQVASLDDYAERL
PANGAVAIVCASYNGVAPDNAAEFHRWLDKADDSLNGVRFSVFGCGNTDWAATYQAVPRR
IDERLGALGATRVHPRGEGDAREDMDGAFQDWSDALWPELVKAFGIQSGADTPAEAEPLY
TLEELPPPQKNALVDALGAVALRVIENRELQKDPGGAGEAGRSTRHVELMLPEGVDYRAG
DHLSVVPRNSPAQVERAMARFGFDRAAHVRLHADSGRKTALPVDQVIAVDRLLGDYVELQ
DVATRKQIATLTAYTECPATRPKLAALSGSDDASQAAYKAQVLHRRRSLLDLLEEHRACQ
LPFAVFLEMLSPLSPRYYSISSSPTMTPGRCSVTVGVVSAPALSGKGTFEGVCSNYLARA
EAGDTVHGVIRETTAEGFRLPEDAQRPLVMIGPGTGLAPFRGFLQERAAQAERGQALGEA
MLFFGCRHPEQDFIYAEELEAWSHRGLMKLHTAFSRAGERKVYVQDLIREQGAAVWKLLE
AGGVIYVCGDGSRMEPDVRRTLADLARGHGHDGAAWMDQMIADQRYVLDVWAGA
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaaaactcgctccatccgatcccgcatcccgccaagaagcccttcgtcggc
aacctgctgtcgatcggctccgactcccccgtgctcgacatgtggaagatcgcgcaggac
ctcggcggcatctactggctcgacatgccgggcatgccggtgatcgtggtgtcctcgccc
gcgctggtcgacgagctgtgcgaagaggcgcgcttcgacaagagcacgcgcggcgcgctg
cggcggcttcgcgcagcgtcgcacggcctcttcacctccgacacgcacgaggaaacctgg
tcgaagccgcacaacatcctgctggccaacttcagccagcgcgccatgcaggcctaccac
ccgatgatgctggacatcgcgggccagctggtcaccaagtgggagcgcctgaacttcgac
gaagaggtggacgtggtgcgcgacatgaccgcgctcacgctcgacaccatcggcctgtgc
ggcttcggctaccgcttcaattcgttctaccgcgagggcttccatcctttcgtcgatgca
atggtgcgcacgctggagacggtacagaaccgccgcggcctgccgctcgaggagttcatg
ctcaagaaggagctcgcgcagcagcgcaaggacatccgcttcatgcacaagatggtggag
gacatcatcgaggagcgccgcgcgggcggggccgacattgccaccaagcccgacctgctg
agctacatgatcgcgggcgtcgacaagaagagcggcgaaaaactcaccgacaagatgatc
cgcgacgagtgcatcgaattcctcatcgcggggcacgagaccaccagcggcctgctctcg
ttcgcgatctacttcctgctgaagaaccccgaggcgctggccaaggcgcaggccgaggtc
gacaacgtgttcggccccgacacctcgcagaagccgacctatgcgcaggtcaaccgcctg
cagtacgtgatgcaggtgctcaaggaggcgctgcgcctgtacccgaccgcgcccgccatc
gcgatgcgcgcgaaggaagacaccaccatcggcggccagtacacgatcaagaagaagaac
atggtcatcatgcatgcgctggcgctgcatcgcgacaagggcatctggggcgaggacgcc
gacgagttcaaccccgaccacttcagccgcgaggccgagcgcgagcggccggtgaatgcc
ttcaagcccttcggcaacgggcagcgcgcctgcatcgggcgccagttcgcattgcaggaa
gcggtgctcacgctgggcatgatcctgcagcgcttcgatctcgtcgaccacacgggctac
aagctccgcatcaaggaggcgctcacgatcaagccggaaggcctcaagatcaaggcgctg
ctgcgcgacccggccacgcggccgcgcggcaacaccgccgatgcggccgccgcgccggtg
cagcccaggcaggccgccgcgcgcaagccgcaggccgcgcggcacggcacctcgctgctg
gtgctgcagggctccaacctcggcacggccgaagatctggcgcgccagttggccgaggcc
ggcgagctgcgcggcttctccacgcaggtggcctcgctcgacgactacgccgagcgactg
cccgccaatggcgccgtcgccatcgtctgcgcctcgtacaacggcgtggcgcccgacaac
gccgccgagttccaccgctggctcgacaaggccgacgattcgctcaacggcgtgcgcttc
agcgtcttcggctgcggcaacaccgactgggccgccacctaccaggcggtgccgcggcgc
atcgacgagcggctcggcgcgctcggcgccacgcgcgtgcatccgcgcggcgagggcgat
gcgcgcgaggacatggacggcgccttccaggactggagcgacgcgctctggcccgaactg
gtgaaggccttcggcatccagtccggcgccgacacgcccgccgaggccgagccgctctac
acgctcgaggaactgccgccgccgcagaagaacgcgctcgtcgacgcgctgggcgcggtg
gcgctgcgcgtgatcgagaaccgcgagttgcagaaagatcccggcggcgccggcgaagcg
ggccgctccacgcgccacgtcgagctgatgctgcccgaaggcgtggactaccgcgctggc
gaccacctgagcgtggtgccgcgcaacagcccggcgcaggtggaacgcgcgatggcgcgc
ttcggattcgaccgcgccgcgcatgtgcggctgcatgccgactcgggccgcaagacggcg
ctgccggtcgaccaggtgatcgcggtcgatcgcctgctcggcgactatgtcgagctgcag
gacgtggccacgcgcaagcagatcgccacgctcacggcatacaccgagtgcccggccacc
aggccgaagctcgccgcgctctcgggcagcgacgacgcctcgcaggccgcctacaaggcc
caggtgctgcacaggcgccggtcactgctcgacctgctcgaggagcaccgcgcctgccag
ctgccgttcgcggtgttcctcgagatgctgtcgccgctctcgccgcgctactactcgatc
tcgtcctcgcccacgatgacgccggggcgctgcagcgtcaccgtgggcgtggtgagcgcg
ccggcgctgtcgggcaagggcaccttcgagggcgtgtgctccaactacctggcgcgcgcc
gaagcgggcgacacggtgcacggcgtgatccgcgaaaccacggccgaaggcttccgcctg
cccgaggatgcgcagcggccgctcgtcatgatcggccccggcaccggccttgcgccgttc
cgcggcttcctgcaggaacgcgcggcgcaggccgagcgcggccaggcgctgggcgaggcg
atgctgttcttcggctgccgccatcccgaacaggatttcatctacgccgaggagctcgaa
gcctggtcgcaccgcggcctgatgaagctacacaccgcgttctcgcgcgcgggcgagcgc
aaggtctatgtgcaggacctgatccgcgagcagggcgcggccgtgtggaagctgctcgaa
gcgggcggcgtgatctacgtgtgcggcgacggttcgcgcatggaacccgacgtgcggcgc
acgctggccgacctggcgcgggggcacggccacgacggcgcggcgtggatggaccagatg
attgccgaccagcgctatgtgctggacgtctgggcgggagcgtag

DBGET integrated database retrieval system