KEGG   Variovorax paradoxus S110: Vapar_4796Help
Entry
Vapar_4796        CDS       T00916                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
vap  Variovorax paradoxus S110
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:vap00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:vap00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:vap00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:5111865..5115089
Genome map
AA seq 1074 aa AA seqDB search
MAGKNSLHPIPHPAKKPFVGNLLSIGSDSPVLDMWKIAQDLGGIYWLDMPGMPVIVVSSP
ALVDELCEEARFDKSTRGALRRLRAASHGLFTSDTHEETWSKPHNILLANFSQRAMQAYH
PMMLDIAGQLVTKWERLNFDEEVDVVRDMTALTLDTIGLCGFGYRFNSFYREGFHPFVDA
MVRTLETVQNRRGLPLEEFMLKKELAQQRKDIRFMHKMVEDIIEERRAGGADIATKPDLL
SYMIAGVDKKSGEKLTDKMIRDECIEFLIAGHETTSGLLSFAIYFLLKNPEALAKAQAEV
DNVFGPDTSQKPTYAQVNRLQYVMQVLKEALRLYPTAPAIAMRAKEDTTIGGQYTIKKKN
MVIMHALALHRDKGIWGEDADEFNPDHFSREAERERPVNAFKPFGNGQRACIGRQFALQE
AVLTLGMILQRFDLVDHTGYKLRIKEALTIKPEGLKIKALLRDPATRPRGNTADAAAAPV
QPRQAAARKPQAARHGTSLLVLQGSNLGTAEDLARQLAEAGELRGFSTQVASLDDYAERL
PANGAVAIVCASYNGVAPDNAAEFHRWLDKADDSLNGVRFSVFGCGNTDWAATYQAVPRR
IDERLGALGATRVHPRGEGDAREDMDGAFQDWSDALWPELVKAFGIQSGADTPAEAEPLY
TLEELPPPQKNALVDALGAVALRVIENRELQKDPGGAGEAGRSTRHVELMLPEGVDYRAG
DHLSVVPRNSPAQVERAMARFGFDRAAHVRLHADSGRKTALPVDQVIAVDRLLGDYVELQ
DVATRKQIATLTAYTECPATRPKLAALSGSDDASQAAYKAQVLHRRRSLLDLLEEHRACQ
LPFAVFLEMLSPLSPRYYSISSSPTMTPGRCSVTVGVVSAPALSGKGTFEGVCSNYLARA
EAGDTVHGVIRETTAEGFRLPEDAQRPLVMIGPGTGLAPFRGFLQERAAQAERGQALGEA
MLFFGCRHPEQDFIYAEELEAWSHRGLMKLHTAFSRAGERKVYVQDLIREQGAAVWKLLE
AGGVIYVCGDGSRMEPDVRRTLADLARGHGHDGAAWMDQMIADQRYVLDVWAGA
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaaaactcgctccatccgatcccgcatcccgccaagaagcccttcgtcggc
aacctgctgtcgatcggctccgactcccccgtgctcgacatgtggaagatcgcgcaggac
ctcggcggcatctactggctcgacatgccgggcatgccggtgatcgtggtgtcctcgccc
gcgctggtcgacgagctgtgcgaagaggcgcgcttcgacaagagcacgcgcggcgcgctg
cggcggcttcgcgcagcgtcgcacggcctcttcacctccgacacgcacgaggaaacctgg
tcgaagccgcacaacatcctgctggccaacttcagccagcgcgccatgcaggcctaccac
ccgatgatgctggacatcgcgggccagctggtcaccaagtgggagcgcctgaacttcgac
gaagaggtggacgtggtgcgcgacatgaccgcgctcacgctcgacaccatcggcctgtgc
ggcttcggctaccgcttcaattcgttctaccgcgagggcttccatcctttcgtcgatgca
atggtgcgcacgctggagacggtacagaaccgccgcggcctgccgctcgaggagttcatg
ctcaagaaggagctcgcgcagcagcgcaaggacatccgcttcatgcacaagatggtggag
gacatcatcgaggagcgccgcgcgggcggggccgacattgccaccaagcccgacctgctg
agctacatgatcgcgggcgtcgacaagaagagcggcgaaaaactcaccgacaagatgatc
cgcgacgagtgcatcgaattcctcatcgcggggcacgagaccaccagcggcctgctctcg
ttcgcgatctacttcctgctgaagaaccccgaggcgctggccaaggcgcaggccgaggtc
gacaacgtgttcggccccgacacctcgcagaagccgacctatgcgcaggtcaaccgcctg
cagtacgtgatgcaggtgctcaaggaggcgctgcgcctgtacccgaccgcgcccgccatc
gcgatgcgcgcgaaggaagacaccaccatcggcggccagtacacgatcaagaagaagaac
atggtcatcatgcatgcgctggcgctgcatcgcgacaagggcatctggggcgaggacgcc
gacgagttcaaccccgaccacttcagccgcgaggccgagcgcgagcggccggtgaatgcc
ttcaagcccttcggcaacgggcagcgcgcctgcatcgggcgccagttcgcattgcaggaa
gcggtgctcacgctgggcatgatcctgcagcgcttcgatctcgtcgaccacacgggctac
aagctccgcatcaaggaggcgctcacgatcaagccggaaggcctcaagatcaaggcgctg
ctgcgcgacccggccacgcggccgcgcggcaacaccgccgatgcggccgccgcgccggtg
cagcccaggcaggccgccgcgcgcaagccgcaggccgcgcggcacggcacctcgctgctg
gtgctgcagggctccaacctcggcacggccgaagatctggcgcgccagttggccgaggcc
ggcgagctgcgcggcttctccacgcaggtggcctcgctcgacgactacgccgagcgactg
cccgccaatggcgccgtcgccatcgtctgcgcctcgtacaacggcgtggcgcccgacaac
gccgccgagttccaccgctggctcgacaaggccgacgattcgctcaacggcgtgcgcttc
agcgtcttcggctgcggcaacaccgactgggccgccacctaccaggcggtgccgcggcgc
atcgacgagcggctcggcgcgctcggcgccacgcgcgtgcatccgcgcggcgagggcgat
gcgcgcgaggacatggacggcgccttccaggactggagcgacgcgctctggcccgaactg
gtgaaggccttcggcatccagtccggcgccgacacgcccgccgaggccgagccgctctac
acgctcgaggaactgccgccgccgcagaagaacgcgctcgtcgacgcgctgggcgcggtg
gcgctgcgcgtgatcgagaaccgcgagttgcagaaagatcccggcggcgccggcgaagcg
ggccgctccacgcgccacgtcgagctgatgctgcccgaaggcgtggactaccgcgctggc
gaccacctgagcgtggtgccgcgcaacagcccggcgcaggtggaacgcgcgatggcgcgc
ttcggattcgaccgcgccgcgcatgtgcggctgcatgccgactcgggccgcaagacggcg
ctgccggtcgaccaggtgatcgcggtcgatcgcctgctcggcgactatgtcgagctgcag
gacgtggccacgcgcaagcagatcgccacgctcacggcatacaccgagtgcccggccacc
aggccgaagctcgccgcgctctcgggcagcgacgacgcctcgcaggccgcctacaaggcc
caggtgctgcacaggcgccggtcactgctcgacctgctcgaggagcaccgcgcctgccag
ctgccgttcgcggtgttcctcgagatgctgtcgccgctctcgccgcgctactactcgatc
tcgtcctcgcccacgatgacgccggggcgctgcagcgtcaccgtgggcgtggtgagcgcg
ccggcgctgtcgggcaagggcaccttcgagggcgtgtgctccaactacctggcgcgcgcc
gaagcgggcgacacggtgcacggcgtgatccgcgaaaccacggccgaaggcttccgcctg
cccgaggatgcgcagcggccgctcgtcatgatcggccccggcaccggccttgcgccgttc
cgcggcttcctgcaggaacgcgcggcgcaggccgagcgcggccaggcgctgggcgaggcg
atgctgttcttcggctgccgccatcccgaacaggatttcatctacgccgaggagctcgaa
gcctggtcgcaccgcggcctgatgaagctacacaccgcgttctcgcgcgcgggcgagcgc
aaggtctatgtgcaggacctgatccgcgagcagggcgcggccgtgtggaagctgctcgaa
gcgggcggcgtgatctacgtgtgcggcgacggttcgcgcatggaacccgacgtgcggcgc
acgctggccgacctggcgcgggggcacggccacgacggcgcggcgtggatggaccagatg
attgccgaccagcgctatgtgctggacgtctgggcgggagcgtag

DBGET integrated database retrieval system