KEGG   Variovorax paradoxus S110: Vapar_4926Help
Entry
Vapar_4926        CDS       T00916                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vap  Variovorax paradoxus S110
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vapar_4926
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Vapar_4926
Exosome [BR:vap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vapar_4926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:5234693..5235682
Genome map
AA seq 329 aa AA seqDB search
MYPAGRPRRLRRDSFTRNLVREHALTAHDLIYPVFVQEGEKKRDAVASMPGVDRLSLDLL
LPVAEQCVEAGIPVMALFPVIDAGLKTPAGDEAFNPEGLIPRVVAALKSRFPELGVMTDV
ALDPYTSHGQDGLLDDTGYILNDATVEVLVKQALTQSQAGVDIVAPSDMMDGRIGAIRTA
LEARGDIHTRIMAYSAKYASAFYGPFRDAVGSAATLGKSNKKVYQMDPGNSDEALREVGL
DIAEGADMVMVKPGMPYLDIVRRVKDEFRVPTFAYQVSGEYAMLKAAAQNGWLDHDAVVL
ESLLAFKRAGADGVLTYFALDAARLLQKQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtaccccgccggccggccgcgccgcctgcgccgcgacagcttcacccgcaacctcgtc
agggagcatgcgctgacggcgcacgacctcatctacccggtgttcgtgcaggaaggcgag
aaaaagcgcgacgccgtggcgtcgatgcccggcgtggatcgcctgagcctcgacctgctg
ctgccggtggccgagcagtgcgtggaggccggcatcccggtgatggcgctctttccggtg
atcgatgccggcctcaagacgcccgcgggcgacgaggccttcaatcccgaggggctgatt
ccgcgcgtggtcgcggcgctgaagtcgcgctttccggagctcggcgtgatgaccgacgtg
gcgctcgacccctacaccagccacgggcaggacggcctgctcgacgacaccggctacatc
ctcaacgacgccaccgtggaagtgctggtgaagcaggcgctcacacagtcgcaagccggc
gtggacattgtggcgcccagcgacatgatggacgggcgcattggcgcgatccgcaccgcg
ctggaagcccgcggcgacatccacacccgcatcatggcctacagcgccaagtacgcgagc
gccttctacggcccgttccgcgatgccgtgggctcggccgcgacgctcggcaagagcaac
aagaaggtctaccagatggacccgggcaacagcgacgaggcgctgcgcgaagtgggcctg
gacattgccgagggcgccgacatggtgatggtcaagcccggcatgccctacctggacatc
gtgcgccgcgtgaaggacgaatttcgcgtacccaccttcgcctaccaggtgagcggcgaa
tacgcgatgctcaaggccgcggcccagaacggctggctcgaccacgatgcggtggtgctc
gaaagcctgctcgccttcaagcgcgccggcgccgacggcgtgctcacctactttgcgctc
gacgccgcgcggttgctgcaaaaacaatag

DBGET integrated database retrieval system