KEGG   Variovorax paradoxus S110: Vapar_5192Help
Entry
Vapar_5192        CDS       T00916                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vap  Variovorax paradoxus S110
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_5192
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vapar_5192
   00640 Propanoate metabolism
    Vapar_5192
   00660 C5-Branched dibasic acid metabolism
    Vapar_5192
Enzymes [BR:vap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Vapar_5192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(5515085..5516251)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILAKFGVPVPRGIPAYTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEDVKKLAGEILGMQLKTHQTGPEGQKVRRLYIEDGADINKEYYVSAVTDRATQK
VAFIASSEGGMDIEEVAHSSPEKIITVFADPEKGLTDEQAKQIADGIGMPADSTAQTVDI
LKKLYTCYMETDASLVEINPLNRDSKGKVMALDAKFNFDSNALFRHPEIVALRDLDEEDA
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNKNVEAILVNIFGGIMKCDTIATGVIAACKAVNLQVPLVVRMKGTNEVEGKKL
LADSGLPIISADTMADAAQKVVAAVKKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccaaggcaaggaaatccttgccaagttcggcgtgccggtgccg
cgcggcattccggcctatacggttcaggaggcggtcgaggccgcccagaaacttggaggc
ccggtgtgggtcgtcaaggcccagatccacgcgggtggccgcggcaagggcggcggcgtc
aaggtcgccaagtccatcgaggacgtcaagaagctcgccggcgagatcctcggcatgcag
ctcaagacccaccagaccggccccgaaggccagaaggtgcgccgcctctacatcgaagat
ggcgccgacatcaacaaggaatactacgtctcggccgtgaccgaccgcgccacgcagaag
gtcgcgttcattgcctcgagcgaaggcggcatggacatcgaggaagtggcccactcctcg
cccgagaagatcatcaccgtgttcgcggaccccgaaaagggcctgaccgacgagcaggcc
aagcagatcgccgacggcatcggcatgccggccgattccaccgcccagacggtcgacatc
ctcaagaagctctacacctgctacatggagacggacgcctcgctggtcgagatcaacccg
ctcaaccgtgacagcaagggcaaggtcatggcgctggacgccaagttcaacttcgacagc
aacgcgctgttccgccaccccgaaatcgtggccctgcgcgacctcgacgaagaagacgcg
gccgaagtcgaagcctccaagttcgacctcgcctacatctcgctggatggcaacatcggc
tgcttggtgaacggtgccggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctggacgtgggcggcggcgccacccccgagaaggtcaccgaa
gccttcaagatcatgctgaagaacaagaacgtggaagccatcctcgtgaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtgatcgcagcctgcaaggccgtgaac
ctgcaagtgccgctggtcgtgcgcatgaagggcaccaacgaagtcgaaggcaagaagctg
ctggccgattcgggcctgccgatcatcagcgccgacaccatggcggacgcggcccagaag
gtcgtcgcagcggtcaaaaaggcctaa

DBGET integrated database retrieval system