KEGG   Variovorax paradoxus S110: Vapar_5258Help
Entry
Vapar_5258        CDS       T00916                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:vap01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vap01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vap00010]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:vap00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(5577643..5578644)
Genome map
AA seq 333 aa AA seqDB search
MAIKLGINGFGRIGRNVLRAAVQNFKNDIEIVAINDLLEPDYLAYMLQYDSVHGRFKGEV
TVEGNTLIVNGKKIRLTQERDPAQLKWNEVGADIVLESTGLFLTKETCQKHLDAGAKKVI
MSAPSKDDTPMFVYGVNDKKYAGEAIVSNASCTTNCLAPLAKVLNDKWGIKRGLMTTVHA
ATATQKTVDGPSNKDWRGGRGILENIIPSSTGAAKAVGVVIPELNKKLTGMSFRVPTSDV
SVVDLTVELEKEATYKEICAEMKSQSEGALKGVLGYTEDKVVATDFRGDPRTSIFDAEAG
IALDGTFVKLVSWYDNEWGYSNKCLEMVKVVAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaactcggtatcaatggcttcggtcgcatcggtcgcaacgtgctgcgcgca
gcggtgcagaacttcaagaacgacatcgagatcgtcgccatcaacgacctgctcgagccc
gactacctggcctacatgctccagtacgactcggtgcatggccgcttcaagggcgaagtc
acggtggaaggcaacacgctgatcgtcaacggcaagaagatccgcctcacgcaggagcgc
gaccccgcgcagctgaagtggaatgaagtcggcgccgacatcgtgctcgaatccaccggc
ctcttcctcaccaaggaaacctgccagaagcacctcgacgcgggcgcgaagaaggtgatc
atgtcggcgccgtcgaaggacgacacccccatgttcgtctacggcgtgaacgacaagaag
tacgccggcgaagccatcgtcagcaacgccagctgcaccaccaactgcctggcgccgctg
gccaaggtgctgaacgacaagtggggcatcaagcgcggcctgatgaccaccgtgcacgcc
gccaccgccacgcagaagaccgtcgacggcccgagcaacaaggactggcgcggcggccgc
ggcatcctggaaaacatcattccctcgagcaccggcgccgccaaggccgtgggcgtggtg
atccccgagctcaacaagaagctcacgggcatgagcttccgcgtgccgacctccgacgtg
tcggtggtcgacctcacggtggagctcgagaaggaagccacctacaaggaaatctgcgcc
gagatgaagtcgcagagcgaaggcgcgctcaagggcgtgctgggctacaccgaggacaag
gtggtggccaccgacttccgcggcgacccgcgcacctcgatcttcgacgccgaagccggc
attgcgctggacggcaccttcgtgaagctcgtgagctggtacgacaacgaatggggctac
tcgaacaagtgcctggagatggtgaaggtcgtggcgaagtaa

DBGET integrated database retrieval system