KEGG   Variovorax paradoxus S110: Vapar_5271Help
Entry
Vapar_5271        CDS       T00916                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Vapar_5271
Transfer RNA biogenesis [BR:vap03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Vapar_5271
 Prokaryotic Type
    Vapar_5271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:5594844..5595254
Genome map
AA seq 136 aa AA seqDB search
MAAYASITSSVTKFALTGLMLVALATGAEARGWFGTGKPAQESIALSELPVQGQRTYEAI
LSGGPFRFEKDGTVFGNRERLLPPARRGHYREYTVATPGSRDRGARRIVCGGEQRTTPEA
CWYTADHYASFRRIAP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttacgcctcgatcacgtcttctgtcactaagtttgcgctcaccggcttgatg
ctggtggcattggcgacgggggccgaggcccgcggatggttcggcaccggaaagcccgcc
caggaatcgattgcactgtccgaactgccggttcagggccagcgaacctacgaagccatc
ctgagtggcggccccttccgattcgaaaaggacggcacggtatttggcaaccgcgagcgt
cttttgccgcccgcgcggcgcggtcactaccgcgagtacacggtggcaacgcccggctcg
cgcgatcgcggtgcacggcgcattgtctgcggcggagaacagcgcaccacacccgaggcc
tgctggtacacggcagaccactacgcgagtttcagacggattgcaccatga

DBGET integrated database retrieval system