KEGG   Variovorax paradoxus S110: Vapar_5335Help
Entry
Vapar_5335        CDS       T00916                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00010  Glycolysis / Gluconeogenesis
vap00020  Citrate cycle (TCA cycle)
vap00620  Pyruvate metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
Module
vap_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_5335
   00020 Citrate cycle (TCA cycle)
    Vapar_5335
   00620 Pyruvate metabolism
    Vapar_5335
Enzymes [BR:vap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Vapar_5335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N PYNP_C HlyD_D23 HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: ACS21937
JGI: Vapar_5335
UniProt: C5CZC9
Position
2:35942..37222
Genome map
AA seq 426 aa AA seqDB search
MSNAIDIKVPDIGDFSDVPVIEIFVKVGDTVKAEDPIVSLESDKATMDVPAPISGVVTAI
GIKIGDKVSEGSVILSLATGDVPVAAAAPSPQPSPAGGRGSEAAAVLPAGNAEVEAGFAL
AYAGPAVRKLARELGVDLGKIKGTGDHGRIVRADVEGFAKGGGTSAAPAASKAAPAGGGV
GGIDLLPWPKVDFAKFGPTERKELSRIKKISAANLHRNWVVIPHVTTHDEADITELEPFR
VQMNKELEKSGVKISMLPFMMKAAVAALKKFPDFNASLDGDALVLKNYWHIGFAADTPNG
LMVPVIRDVDKKTVPEIAKEMGELAKLARDGKLKPDQMSGGTFTISSLGGIGGIYFTPII
NAPEVAIMGVCKSYWKQHSSDGKTWTSRLTLPLSLSWDHRVIDGAAAARFNVYFANVLAD
LRRVLF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcaatcgacatcaaggtgcccgacatcggcgacttcagcgacgtgcccgtc
atcgagatcttcgtgaaggtcggcgacacggtgaaggccgaggatccgatcgtctcgctc
gaatccgacaaggcgacgatggatgtgcccgcgccgatctcgggtgtggtgacggccatc
ggcatcaagatcggagacaaggtcagcgaagggtcggtgattctttcgctggcgacgggt
gatgtgcctgtcgcggcggccgctccctcaccccaaccctctcccgcgggcgggagaggg
agcgaagcggcggcggtgctgcctgccggcaacgcggaagtcgaagccggcttcgcgctt
gcctatgccgggccggccgtgcgcaagctggcacgcgaactcggcgtcgacctgggcaag
atcaagggcaccggcgaccatggccgcatcgtgcgcgccgacgtcgagggcttcgcgaag
ggtggcggtacgtctgccgcaccggctgcgtccaaggccgcacccgcaggcggtggtgtc
ggcggcatcgacctgctgccctggcccaaggtcgacttcgccaagttcggcccgaccgaa
cgcaaggagctctcgcgcatcaagaagatcagcgccgccaacctgcaccgcaactgggtc
gtcattccgcatgtgacgacgcacgacgaggccgacatcaccgagctcgaacccttccgc
gtgcagatgaacaaggagctggaaaagtcgggcgtgaagatcagcatgctgcccttcatg
atgaaggcggccgtggccgcgctgaagaagttcccggatttcaacgcgagcctcgacggc
gacgccctggtgctcaagaactattggcacatcggcttcgcggccgacacgcccaacggg
ctcatggtgccggtgatccgcgacgttgacaaaaagaccgtgcccgagatcgccaaggag
atgggcgagctcgccaagctcgcgcgcgacggcaagctcaagcccgaccagatgtcgggc
ggcaccttcaccatcagctcgctcggcggcattggcggcatctacttcacgccgatcatc
aacgcgcccgaggtcgccatcatgggcgtgtgcaagagctactggaagcagcactcttcg
gacggcaagacctggacctcgcgcctcacgctgccgctgtccctgtcgtgggaccaccgc
gtgatcgacggcgccgccgccgcgcgcttcaacgtctatttcgccaacgtgctcgccgac
ctgcggcgcgtgctgttctga

DBGET integrated database retrieval system