KEGG   Variovorax paradoxus S110: Vapar_5525Help
Entry
Vapar_5525        CDS       T00916                                 

Definition
Glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
vap  Variovorax paradoxus S110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Vapar_5525
Enzymes [BR:vap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Vapar_5525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:226303..227694
Genome map
AA seq 463 aa AA seqDB search
MSFSVASPQDPAFEPWLETQLRHSAAAMLSSISPVSVVKHRPGFGQTVRPIAGAIVASPV
LADYNPDPDYFFHWFRDSAVVIDALRLLHLEGRIGDEALQHLRDFIRFSLDLNRLDGRAA
AAVENRSACVAPELLQYWREDHDLAKAFGDLVAAETRVNPDGTLDVCRWNRPQHDGAPLR
ALALLRWAAGGHLDAPLLAEAAELIRFDLDFTLRRWREPSYDIWEEELGQHYYTLRVAGA
ALAEGAAWLEGLGDAAQAQRCREESRAVLRLLDGYWVDERGERGAAPGYYRSRALEDGRP
GPKALDIAVILSAIHSLGTEAAHGPADPRMQATLARLDALFDAAYPINHGRAERLGAAMG
RYGGDVYYSGGAYYFSTLGAAEFCFRAAAAMGGDARHWLERGDAYLATVRAYTPASGDLS
EQFDQRSGAQTSAKQLAWSHAAFISCVSARRSAAAACEASRQR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcagcgtggcgagcccgcaagacccggcattcgagccctggctcgaaacacag
ctgcgccattcggcggcggcgatgctgtccagcatttcgccggtgtcggtcgtcaagcac
cggccgggcttcggccagaccgtgcggccgatcgcgggcgccatcgtcgcctcgcccgtg
cttgccgactacaacccggacccggactacttctttcattggttccgcgattccgccgtg
gtcatcgatgcattgcgcctgctccaccttgaggggcgcatcggcgacgaagccctgcag
cacctgcgcgacttcatccgcttcagcctggacttgaaccgcctcgacggccgcgcggct
gccgcggtggagaaccgcagcgcgtgcgtggcccccgagctcctgcagtactggcgcgag
gaccatgaccttgccaaagccttcggcgacctggtggccgccgagacgcgcgtgaacccc
gacggcacgctcgacgtctgccgatggaatcgcccccagcacgacggcgcgccgctgcgc
gcgctggcgctgctgcgctgggcggccggcggccacctcgacgcgccgctgctggcggaa
gctgccgagctgatccgtttcgatctggacttcacgctgcgccgctggcgcgagccgtcc
tacgacatctgggaagaggagctcggccagcactactacacgctgcgtgtcgcaggtgcg
gcgctggccgaaggcgcggcgtggctggagggcctgggcgatgcggcgcaggcgcagcgc
tgccgggaagagtcgcgcgcggtgctgcgcctgctcgacggctactgggtggacgaacgc
ggcgaacgcggcgcggcgcccggctactaccgctcgcgcgcgctggaagacggccggccc
ggcccgaaggcgctggacatcgcggtgatcctgtcggcgatccacagcctcggcaccgag
gccgcgcatggaccggccgatccgcgcatgcaggccacgctggcgcgcctggacgcgctg
ttcgatgcggcctatcccatcaaccatggccgtgccgagaggcttggcgcggcaatgggc
cggtatggcggcgatgtgtactactcgggcggcgcgtactacttctcgacgctcggcgcc
gccgagttctgctttcgtgctgccgcagcgatgggcggcgatgcacgccattggctcgaa
cgcggcgacgcctacctcgccaccgtgcgcgcgtacacgccggccagcggcgacctgtcg
gaacagttcgaccagcgcagcggcgcgcagacctcggccaagcaactggcctggagccac
gccgcgttcatttcgtgtgtctcggcgcgccgcagcgcggccgccgcctgcgaggcgtcg
cggcagcgatga

DBGET integrated database retrieval system