KEGG   Variovorax paradoxus S110: Vapar_5658Help
Entry
Vapar_5658        CDS       T00916                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
vap  Variovorax paradoxus S110
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vap00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:vap00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:vap02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(363719..365509)
Genome map
AA seq 596 aa AA seqDB search
MRIHDEKKNNGEASHAVHDADTDPSQALSGTTRRSLLRSAVLFAMFSGSGIGLTACGGGG
GGGGGGGIGIGGGVGGGRPPDDSNSVFKHGIASGDPLSDRVILWTRVTAAAPGTLNVEWE
VASDERFGIIVARGTASTGPEHDYTVKVDAMGLQPASTYFYRFLMGNDHSPIGRTRTLPV
GGVSQARLAVVSCSNFPSGYFNVYADIAKRTDIDVVLHLGDYIYEYGVVGYASQLAIAID
RTSNPDHEILTLADYRLRHAQYRTDGDLRALHARLPMIAVWDDHDLANGAWSGGAGNHDE
ATEGSFAARRAAAVQAYHEWLPTRLPDPANPLRIYRSFDFGTLASMHMLDTRLIGRDKQV
TLSQYLAGEASAATRQLMGQPQVDWLSQRMAASPCTWQVLGQQVLMMRMAIPVSIATDFS
LETLSAYLAAQALPDSARSDSQRALITQQKVPYNLDAWDGYPAARDVVLAMARNQGKNLI
SLAGDTHNAWAGNLTDASGQRVGVEFGTSSVSSPGFERALPLIANDLLADGFRRMVDDLR
YAETSKRGYAVLTLTPAEARCDYIEISTVLSRDYSVRTAATLRVLPGVGNLQVLAA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatccacgacgagaagaagaacaacggcgaggcaagccatgccgttcacgatgca
gacaccgacccctcgcaagccctgagcggcaccacccggcgctcgctgctgcgcagcgcc
gtgctgttcgcgatgttctcgggcagcggcatcggcctgaccgcctgcggcgggggcggc
ggaggaggaggaggagggggcatcggcatcggcggcggagtggggggcgggcgtccgccc
gacgactccaactcggtgttcaagcacgggatcgcgagcggcgatcccctgtccgaccgc
gtgatcctctggacccgcgtgacggccgccgcgccgggcaccctcaacgtcgagtgggaa
gtggccagcgacgagcgcttcggcatcatcgtggcgcgcggcaccgcgagcaccggtccc
gagcacgactacacggtcaaggtggacgccatggggctccagccggccagcacctatttc
tatcgcttcctgatgggcaacgaccactcgcccatcggccgcacccgcacgctgccggtg
ggcggcgtatcgcaggccaggctggcggtggtgtcgtgctccaatttcccgagcggctac
ttcaacgtctatgccgacattgccaagcgcaccgacatcgacgtggtgctgcacctgggc
gactacatctacgagtacggggtggtgggctatgcgtcgcagctggccattgcgatcgac
cgcacatcgaaccccgaccacgagatcctgacgctcgccgactaccgcctgcgccatgcg
cagtaccgcaccgacggcgacctgcgcgccctgcatgcgcggctgcccatgatcgcggtg
tgggacgaccatgacctggccaacggcgcatggtccggcggcgccgggaaccacgacgaa
gcaaccgagggcagctttgcggcccggcgcgcggccgccgtgcaggcctaccacgagtgg
ctgccgacgcggctgcccgacccggcgaacccgctgcggatctaccgctccttcgacttc
ggcacgctggcttcgatgcacatgctcgacacccggctgatcggccgcgacaagcaggtc
acgctctcgcagtacctggccggcgaggcttcggcggccacgcggcagctgatgggccag
ccgcaggtggactggctgtcccagcgcatggccgcatcgccctgcacctggcaggtgctc
ggccagcaggtgctcatgatgcgcatggccatccccgtgagcatcgcgaccgacttcagc
ctcgagacgctgagcgcctacctggcggcgcaggcgcttccggattccgcccgcagcgac
agccagcgcgcgctgatcacgcagcagaaggtgccctacaacctggacgcgtgggacggc
tacccggccgcgcgcgacgtggtgctcgccatggcgcgcaaccagggcaagaacctgatc
tcgctggccggcgacacgcacaacgcctgggccgggaacctcaccgacgcctccgggcag
cgggtcggcgtggaattcggaacctcgtcggtgtcgtcgcccggcttcgagcgggcgctg
ccgctgattgccaacgacctgctggccgatggcttccggcgcatggtcgacgacctgcgc
tacgccgagaccagcaagcgcggctatgcggtgctgaccctcacgccggccgaagcgcgc
tgcgactacatcgagatcagcacggtgctgagccgcgactattcggtgaggaccgcagcc
acgctgcgcgtgctgcccggtgtcggcaacctgcaggtgctcgctgcctga

DBGET integrated database retrieval system