KEGG   Variovorax paradoxus S110: Vapar_5874Help
Entry
Vapar_5874        CDS       T00916                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00071  Fatty acid degradation
vap00280  Valine, leucine and isoleucine degradation
vap00281  Geraniol degradation
vap00310  Lysine degradation
vap00362  Benzoate degradation
vap00380  Tryptophan metabolism
vap00410  beta-Alanine metabolism
vap00640  Propanoate metabolism
vap00650  Butanoate metabolism
vap00903  Limonene and pinene degradation
vap00930  Caprolactam degradation
vap01040  Biosynthesis of unsaturated fatty acids
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
vap01212  Fatty acid metabolism
Module
vap_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Vapar_5874
   00650 Butanoate metabolism
    Vapar_5874
  Lipid metabolism
   00071 Fatty acid degradation
    Vapar_5874
   01040 Biosynthesis of unsaturated fatty acids
    Vapar_5874
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vapar_5874
   00310 Lysine degradation
    Vapar_5874
   00380 Tryptophan metabolism
    Vapar_5874
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Vapar_5874
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Vapar_5874
   00281 Geraniol degradation
    Vapar_5874
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Vapar_5874
   00930 Caprolactam degradation
    Vapar_5874
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Vapar_5874
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Vapar_5874
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Vapar_5874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH Sacchrp_dh_NADP AlaDh_PNT_C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACS22458
JGI: Vapar_5874
UniProt: C5D0B4
Position
2:583195..585279
Genome map
AA seq 694 aa AA seqDB search
MKTLQYDLDTGTGVVTLTFDDLDASVNTFNDAWRTDMQAALDRMSEGGSRPRGVILASAK
DTFFAGANLKDVLAQWPADPAQVFARTEAGKKLLRRLETLGCPVVACIAGSALGGGFELA
LCAHHRVVVDDARVQLGFPEVGLGLIPAGGGVTKLVRLLGLESAMPYILESRVMSPSAAR
DAGLVHAVVPSGLGAAAALREAALAWIEAHPQAQQPWEVKGHRIPGGAPGCPKLAPLQML
APAMLFQKTRGRYPAAEAALSCMVEGAQLDVDTALRLETRALVGLLTHPVTRNLIQLFFD
RNAVRRGRSRPQGVAPWQAGKVSILGAGMMGAGIAQVCAAHSLNVVLKDVSIEFAEAGKE
RVRRLTDQRVHAGRMTPSQQAAILERIEPAAEVSALDGSDLIIETVFEDRALKGRATGEA
EPCLRPDGVFASNTSTLPITGLAEAVSMPERFIGLHFFSPADRMELVEIVVAEKTSAETL
ARAYDFVLQIGKTPIVVRDARGFFTSRTVGSYMAEGAQMLAEGIPATVVELAGRDAGMPV
GPLTVADEISLVTLAKIMEQNASDALDVGERFMIALCRQHGRKGRVLGGGYYDYTEDAPK
TLWPGLKAFERPETSWTLAALSERLLMRQAVEALRCEAEGVVTHAHDANVGSVLGFGFPA
WTGGVLQYVAAMGRDRFMAQAHALAAAHGGRFTP
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcttcagtacgacctcgacaccggcactggcgttgtcacactgaccttcgac
gatctcgatgcctctgtcaatactttcaacgatgcttggcggaccgacatgcaagccgcg
ctcgatcgcatgagcgaagggggcagccggccacgcggtgtcatcctcgcttccgccaag
gacacgttctttgccggcgccaacttgaaggacgtgcttgcgcagtggcccgccgatccc
gcgcaggtgtttgcgcgcaccgaggcgggcaagaagctgctgcgccgactggaaaccttg
ggctgtccggtggtggcgtgcattgccggcagcgcactgggcggcggcttcgagctcgca
ctgtgcgcgcaccaccgcgtggttgtcgacgatgccagagtgcaactcggctttccggag
gttggcctcggcctgattcccgcggggggaggcgtgaccaaactcgtgcgtctgctaggg
ctcgagtccgccatgccgtacatcctggagagccgagtgatgagtccgagcgcagcacga
gatgctggtctcgtacacgccgtggtgccgtccggtctcggcgccgccgcagcgctgcgc
gaggctgcattggcgtggatcgaggcccatccacaggcgcagcagccttgggaggtcaag
ggacaccgcatccccggcggcgcgccgggctgtccgaagctggcaccgctgcagatgctg
gcgccggcgatgcttttccaaaagacgagggggagatacccagccgctgaagcggccttg
agttgcatggtggaaggggcgcaattggatgtggacaccgcgctgcggctggaaacgcga
gcgctcgtcggcctgctgacacaccctgtcacgcgcaacctgatccaactcttcttcgac
cgcaatgccgtcaggcgggggcggtcacgcccacagggtgtcgcgccgtggcaagcgggc
aaggtaagcatcctgggggcgggcatgatgggggccgggatcgcgcaggtctgtgcagcg
cacagtctgaacgtggtgttgaaggatgtgagcatcgaatttgccgaggccggcaaggag
cgtgtccgccgtctgaccgatcagcgtgtgcatgcggggcgcatgacgccgtctcagcag
gctgcgattctggagcgcatcgagcccgccgccgaggtgtcggcgttggacggcagcgac
ctcattatcgagacggtgttcgaggatcgcgcgctcaaaggccgcgcgaccggcgaagcc
gagccgtgcctgcgtccagacggcgtcttcgcgagcaacacgtcgaccctgcccatcacc
gggctagccgaagcggtcagcatgcccgagcgcttcatcggcctgcacttcttttcacct
gccgacaggatggagctcgtggagatcgtcgttgccgagaagaccagtgccgagacgtta
gccagggcctacgacttcgtgctgcagatcggcaagacaccaatcgtggtgcgtgacgcc
cgcggcttctttaccagccgaaccgtcggctcctacatggctgaaggtgcgcagatgctg
gccgagggcattccggcgacggtggtggaactggccggccgtgacgccggcatgccggtg
ggtccgctgaccgtggcggacgagatttcgctggtcacgctggcgaaaattatggagcag
aacgccagtgatgcgttggacgtgggcgagcgcttcatgattgcgctatgcaggcaacac
ggtcgcaagggacgcgttcttgggggcggttactacgactataccgaggacgcacctaag
acactctggccgggcttgaaagcgtttgagcgccccgaaacgtcgtggacgctcgctgca
ttgagcgagcgcctactaatgcgtcaggctgtcgaggcgttgcgctgcgaggccgaaggc
gtggtgacgcatgcacatgacgccaatgtcggctcggtcttgggcttcggattccccgca
tggacaggtggcgtactccaatacgtcgcagcaatgggccgggacaggttcatggcgcaa
gcccatgcgcttgctgcagctcatggtgggcgattcacgccgtga

DBGET integrated database retrieval system