KEGG   Variovorax paradoxus S110: Vapar_5874Help
Entry
Vapar_5874        CDS       T00916                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vap  Variovorax paradoxus S110
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_5874
   01212 Fatty acid metabolism
    Vapar_5874
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Vapar_5874
   00650 Butanoate metabolism
    Vapar_5874
  Lipid metabolism
   00071 Fatty acid degradation
    Vapar_5874
   01040 Biosynthesis of unsaturated fatty acids
    Vapar_5874
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vapar_5874
   00310 Lysine degradation
    Vapar_5874
   00380 Tryptophan metabolism
    Vapar_5874
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Vapar_5874
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Vapar_5874
   00281 Geraniol degradation
    Vapar_5874
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Vapar_5874
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Vapar_5874
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Vapar_5874
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Vapar_5874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:583195..585279
Genome map
AA seq 694 aa AA seqDB search
MKTLQYDLDTGTGVVTLTFDDLDASVNTFNDAWRTDMQAALDRMSEGGSRPRGVILASAK
DTFFAGANLKDVLAQWPADPAQVFARTEAGKKLLRRLETLGCPVVACIAGSALGGGFELA
LCAHHRVVVDDARVQLGFPEVGLGLIPAGGGVTKLVRLLGLESAMPYILESRVMSPSAAR
DAGLVHAVVPSGLGAAAALREAALAWIEAHPQAQQPWEVKGHRIPGGAPGCPKLAPLQML
APAMLFQKTRGRYPAAEAALSCMVEGAQLDVDTALRLETRALVGLLTHPVTRNLIQLFFD
RNAVRRGRSRPQGVAPWQAGKVSILGAGMMGAGIAQVCAAHSLNVVLKDVSIEFAEAGKE
RVRRLTDQRVHAGRMTPSQQAAILERIEPAAEVSALDGSDLIIETVFEDRALKGRATGEA
EPCLRPDGVFASNTSTLPITGLAEAVSMPERFIGLHFFSPADRMELVEIVVAEKTSAETL
ARAYDFVLQIGKTPIVVRDARGFFTSRTVGSYMAEGAQMLAEGIPATVVELAGRDAGMPV
GPLTVADEISLVTLAKIMEQNASDALDVGERFMIALCRQHGRKGRVLGGGYYDYTEDAPK
TLWPGLKAFERPETSWTLAALSERLLMRQAVEALRCEAEGVVTHAHDANVGSVLGFGFPA
WTGGVLQYVAAMGRDRFMAQAHALAAAHGGRFTP
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcttcagtacgacctcgacaccggcactggcgttgtcacactgaccttcgac
gatctcgatgcctctgtcaatactttcaacgatgcttggcggaccgacatgcaagccgcg
ctcgatcgcatgagcgaagggggcagccggccacgcggtgtcatcctcgcttccgccaag
gacacgttctttgccggcgccaacttgaaggacgtgcttgcgcagtggcccgccgatccc
gcgcaggtgtttgcgcgcaccgaggcgggcaagaagctgctgcgccgactggaaaccttg
ggctgtccggtggtggcgtgcattgccggcagcgcactgggcggcggcttcgagctcgca
ctgtgcgcgcaccaccgcgtggttgtcgacgatgccagagtgcaactcggctttccggag
gttggcctcggcctgattcccgcggggggaggcgtgaccaaactcgtgcgtctgctaggg
ctcgagtccgccatgccgtacatcctggagagccgagtgatgagtccgagcgcagcacga
gatgctggtctcgtacacgccgtggtgccgtccggtctcggcgccgccgcagcgctgcgc
gaggctgcattggcgtggatcgaggcccatccacaggcgcagcagccttgggaggtcaag
ggacaccgcatccccggcggcgcgccgggctgtccgaagctggcaccgctgcagatgctg
gcgccggcgatgcttttccaaaagacgagggggagatacccagccgctgaagcggccttg
agttgcatggtggaaggggcgcaattggatgtggacaccgcgctgcggctggaaacgcga
gcgctcgtcggcctgctgacacaccctgtcacgcgcaacctgatccaactcttcttcgac
cgcaatgccgtcaggcgggggcggtcacgcccacagggtgtcgcgccgtggcaagcgggc
aaggtaagcatcctgggggcgggcatgatgggggccgggatcgcgcaggtctgtgcagcg
cacagtctgaacgtggtgttgaaggatgtgagcatcgaatttgccgaggccggcaaggag
cgtgtccgccgtctgaccgatcagcgtgtgcatgcggggcgcatgacgccgtctcagcag
gctgcgattctggagcgcatcgagcccgccgccgaggtgtcggcgttggacggcagcgac
ctcattatcgagacggtgttcgaggatcgcgcgctcaaaggccgcgcgaccggcgaagcc
gagccgtgcctgcgtccagacggcgtcttcgcgagcaacacgtcgaccctgcccatcacc
gggctagccgaagcggtcagcatgcccgagcgcttcatcggcctgcacttcttttcacct
gccgacaggatggagctcgtggagatcgtcgttgccgagaagaccagtgccgagacgtta
gccagggcctacgacttcgtgctgcagatcggcaagacaccaatcgtggtgcgtgacgcc
cgcggcttctttaccagccgaaccgtcggctcctacatggctgaaggtgcgcagatgctg
gccgagggcattccggcgacggtggtggaactggccggccgtgacgccggcatgccggtg
ggtccgctgaccgtggcggacgagatttcgctggtcacgctggcgaaaattatggagcag
aacgccagtgatgcgttggacgtgggcgagcgcttcatgattgcgctatgcaggcaacac
ggtcgcaagggacgcgttcttgggggcggttactacgactataccgaggacgcacctaag
acactctggccgggcttgaaagcgtttgagcgccccgaaacgtcgtggacgctcgctgca
ttgagcgagcgcctactaatgcgtcaggctgtcgaggcgttgcgctgcgaggccgaaggc
gtggtgacgcatgcacatgacgccaatgtcggctcggtcttgggcttcggattccccgca
tggacaggtggcgtactccaatacgtcgcagcaatgggccgggacaggttcatggcgcaa
gcccatgcgcttgctgcagctcatggtgggcgattcacgccgtga

DBGET integrated database retrieval system