KEGG   Variovorax paradoxus S110: Vapar_6382Help
Entry
Vapar_6382        CDS       T00916                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
vap  Variovorax paradoxus S110
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Vapar_6382
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Vapar_6382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1128247..1128642
Genome map
AA seq 131 aa AA seqDB search
MSSGRWLLAAAALAVAAHAWAVPDAVRGEQVYARCLACHALAVDRVGPRHCGLFGRLAGS
VPGFAYSEAMKKSKIVWNDKTLDRFLAKPLAVVPGTAMTYDGVPDAAERADLIAYLKRAN
EAPPCSGRARE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaggccggtggctccttgcggccgccgcactggccgtggccgcgcacgcgtgg
gccgtgcccgacgcggtgcgcggcgagcaggtctatgcgcgctgcctggcctgccatgcg
ctggcggtcgaccgcgtcgggccccggcactgcggcctgttcggccggctggccggcagc
gtgcccggcttcgcctattcggaggccatgaagaaatcgaagatcgtctggaacgacaag
acgctcgaccgcttcctggccaagccgctggccgtggtgcccggcaccgccatgacctac
gacggcgtgcccgacgccgcggagcgcgcggacctgatcgcctacctcaagcgtgccaac
gaagcgccaccatgcagcggccgcgcacgcgagtga

DBGET integrated database retrieval system