KEGG   Variovorax paradoxus S110: Vapar_6382Help
Entry
Vapar_6382        CDS       T00916                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
vap  Variovorax paradoxus S110
Pathway
vap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vap00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Vapar_6382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACS22942
JGI: Vapar_6382
UniProt: C5D222
Position
2:1128247..1128642
Genome map
AA seq 131 aa AA seqDB search
MSSGRWLLAAAALAVAAHAWAVPDAVRGEQVYARCLACHALAVDRVGPRHCGLFGRLAGS
VPGFAYSEAMKKSKIVWNDKTLDRFLAKPLAVVPGTAMTYDGVPDAAERADLIAYLKRAN
EAPPCSGRARE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaggccggtggctccttgcggccgccgcactggccgtggccgcgcacgcgtgg
gccgtgcccgacgcggtgcgcggcgagcaggtctatgcgcgctgcctggcctgccatgcg
ctggcggtcgaccgcgtcgggccccggcactgcggcctgttcggccggctggccggcagc
gtgcccggcttcgcctattcggaggccatgaagaaatcgaagatcgtctggaacgacaag
acgctcgaccgcttcctggccaagccgctggccgtggtgcccggcaccgccatgacctac
gacggcgtgcccgacgccgcggagcgcgcggacctgatcgcctacctcaagcgtgccaac
gaagcgccaccatgcagcggccgcgcacgcgagtga

DBGET integrated database retrieval system