KEGG   Vigna angularis (adzuki bean): 108323317Help
Entry
108323317         CDS       T04660                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
var  Vigna angularis (adzuki bean)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    108323317
   00500 Starch and sucrose metabolism
    108323317
Enzymes [BR:var01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     108323317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 562 aa AA seqDB search
MTMPTMCLLILFSVIYGSVATHHFSRNLQTLSSDSNDQPYRTAYHFQPPKNWINDPNGPM
RYGGLYHLFYQYNPKGAVWGNIVWGHSVSKDLVNWTTLDPAIFPSQPSDINGCWSGSTTL
LPGNKPTILYTGINSMNKQVQNLAKPKNLSDPFLREWVKFPQNPVMAPTSDNNIVPDSFR
DPTTAWLGQDGHWRVLVGSRRRTRGMALLYRSKDFVNWVQAKHPFYSTKDSGMWECPDFF
PVLKNGQLGVETSVNGDDVRHVLKASLKGHDDYIIGNYNTSKDVFVPDKGFDEFVLRFDY
GKYYASKSFFDDGKKRRVLLGWVDESSSEADDIKKGWSGIIAIPRAIWLHRSGKQLVQWP
VMEIEKLHANPVNLPPQVLKGGQLLQINGVTATQADVEISFEVSKLIEAEVLDNWTDPQI
LCSQKGSSIKSELGPFGLLVFASEGLQEFTSVFFRIFKYQNKNLVLLCSDQSRSSLNKDN
DLTTYGAFVDVEPLHEQLSLRTLTDHSVVESFGGEGRACITARVYPTLAINDKAQLYAFN
NGTADVNITRLNAWSMKKAQIN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgcctactatgtgtttgttaattctcttttctgtcatttatggcagtgtagct
actcatcattttagcagaaatcttcagactctgtcttctgattccaatgatcaaccttac
agaactgcttaccacttccaacctcccaagaattggataaatgatcccaatggaccaatg
agatatggaggactttaccatctgttctatcaatacaatccaaaaggtgcagtttgggga
aatattgtgtggggacattcagtgtcaaaggatcttgtgaactggaccacactagatcct
gccatcttcccatctcagccgtctgatataaatggttgttggtcaggatcaaccacactg
cttcctgggaacaaaccaaccattttgtacacaggaattaactctatgaataaacaagtt
caaaacttggccaagcccaaaaatttgtctgacccttttcttagggaatgggttaagttc
ccccaaaaccctgtaatggcaccaactagtgataacaatatagttccagactcatttagg
gatcccaccactgcttggctaggacaagatggacactggagagtacttgttggaagcaga
agaagaactaggggaatggcactgttgtataggagcaaagactttgttaattgggttcaa
gccaagcaccctttttattcaaccaaagacagtggaatgtgggagtgcccagattttttt
ccagttttgaagaatggtcaattgggtgttgagacatctgtgaatggtgatgatgttagg
catgtactcaaggctagcttgaaaggacatgatgattatattatagggaattacaatact
tccaaggatgtgtttgtccctgataaagggtttgatgaatttgttttaagatttgattat
ggaaaatactatgcctcaaaatctttctttgatgatggaaagaagagaagggttttgctt
gggtgggtggacgaatcatcaagtgaggcagatgatatcaagaaaggatggtctggaatc
attgcaattccaagggccatttggttgcacaggtctggtaaacagctggtacaatggcct
gtgatggaaattgaaaagcttcatgcaaacccagtgaacttgcccccacaagtactaaaa
ggaggacaattgcttcaaattaatggtgttacagcaacacaggctgatgttgaaatttca
tttgaagtgagtaaattgatagaggctgaagtattggacaattggacagacccccaaatt
ctgtgtagtcaaaagggttcatccattaaaagtgaattggggccgtttggtctgctagtt
tttgcttctgagggattgcaagagttcacatcagttttcttcagaatattcaaataccaa
aataaaaatttggtgctcttatgcagtgatcaaagcaggtcttccttaaataaagacaat
gatttgaccacttatggagcttttgttgacgtggaacctcttcatgaacagctttcattg
agaacactgactgatcattctgtcgtagagagttttggaggagagggaagagcttgtatc
acagccagagtttaccccacattggcgatcaatgataaagcacaactatatgctttcaat
aatggcactgctgatgttaatattacaagactgaatgcttggagcatgaagaaagcacaa
ataaattga

DBGET integrated database retrieval system