KEGG   Vibrio campbellii: M892_03085Help
Entry
M892_03085        CDS       T02837                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
vca  Vibrio campbellii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M892_03085
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M892_03085
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M892_03085
Enzymes [BR:vca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     M892_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(698411..700084)
Genome map
AA seq 557 aa AA seqDB search
MSLSRRDFIKVLSSGAVATTLTACGSDDTNTVTDASFEHGVASGDPTQTQVIIWTRVTTE
ASYVDVSWQVSATEDFSSIEQSGTFATDTSRDFTVKVDVQNLNPNTQYYYRFMVGEASSI
VGITQTLPEGSVDKASMAVVSCANYPAGYFNVYKEILEQHQKASFDVVLHLGDYIYEYGA
GGYASEDAAALGREPSKGTECITLDDYRKRYAQYRQDEDLQALHAALPMIAIWDDHELAN
DAWKEGAENHHNSEGSFNDRRAAAAAAWTEWLPVRENTFSNMLIYRQFAFGDLINLMMLD
TRLVGRDQPLDYFSLDAPTMEAIGGLVAQSRSTERELLGTEQLAWLMNAFNQEAKWNVLG
QQVLMSRMELPSSVMLAMFQLFTATDEQKMDALLAVNNAIASYLADPSSDTVKLPYNLDA
WDGYYVERERVYEIAKASSGNFVCLAGDTHNAWTSELKDVSNNPVGVEFATSSVSSPGLE
EYLALEPVAIAQMEYTLPNLVSELQWTDIKQRGFMRVTFTPEKAESTWYMLSTIKDRNYQ
VTKKVASTSDGLTLDIE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtctcgccgagattttataaaagtcctctcttcaggagccgttgctaccaca
ctaactgcatgtgggagtgatgatacaaatacagtcaccgatgcctcattcgaacatggt
gtcgccagtggtgacccaactcaaactcaagtaatcatctggacacgagtgactacggag
gcgagttatgtcgatgtctcttggcaggtgtctgcaacggaagatttctctagtattgag
caaagcggcacctttgcgacagataccagtcgtgatttcacggtgaaggtagatgtgcaa
aatctcaaccccaatacacagtattactaccgttttatggtcggtgaggcgagcagtatt
gtaggcataacgcagactctaccagaaggcagtgtagacaaagcatcgatggccgttgtg
tcttgtgcgaattatccggcgggttacttcaatgtctataaagagattttggaacagcac
caaaaagcgtcgttcgatgtggttttgcaccttggcgattacatctacgaatatggtgct
gggggttatgcgagtgaggatgcggcagcattggggcgtgagccaagcaagggcaccgaa
tgtattacgttagatgactaccgaaagcgctacgctcaatatcgccaagatgaagatctc
caagctctgcatgcagcattaccgatgatcgcaatctgggatgaccacgagttagcaaac
gatgcatggaaagagggggcggaaaaccaccataacagcgaaggcagttttaatgacaga
cgcgccgcggcggcagcggcttggactgagtggcttcctgtgcgagaaaataccttttca
aatatgctgatttatcgtcagtttgcctttggtgatttgatcaacttgatgatgctcgat
actcgattggtaggccgtgaccagccattggattatttttctctcgatgctccaactatg
gaggcgattggcggattagttgctcagtctcgcagtacagaacgagaactacttggtaca
gagcaactcgcttggttaatgaatgcgtttaatcaagaagcaaagtggaatgtgcttggg
cagcaggttcttatgtcgagaatggagctacctagctcggtgatgttggcgatgttccaa
ctctttacggcgacggatgagcagaaaatggacgcgctgctagcagtgaataatgcgatc
gccagttatcttgctgatccaagttcggacactgtaaagttgccatacaacctagacgct
tgggatggctattatgtggagcgtgagcgtgtttatgaaatcgctaaagcaagctcaggc
aattttgtttgcttagctggtgatacgcacaatgcttggaccagtgaactgaaggatgtg
tcaaacaaccctgttggtgtcgagttcgcgacaagttcggtcagctctccgggcctggaa
gaatatttagcgttggagcctgtcgccattgctcaaatggaatatacattgccgaatcta
gtttctgaactgcaatggacagacatcaagcaacgtggctttatgcgtgtcacctttaca
ccagagaaagcagagtcaacgtggtatatgttgtctacgattaaagatagaaactatcaa
gtaaccaaaaaagtggcatccacatcggatggcttgacgcttgatatagagtag

DBGET integrated database retrieval system