KEGG   Vibrio campbellii: M892_12400Help
Entry
M892_12400        CDS       T02837                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vca  Vibrio campbellii
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M892_12400
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M892_12400
  Energy metabolism
   00680 Methane metabolism
    M892_12400
Enzymes [BR:vca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M892_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2672437..2675070)
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVRMLGHLLGNTIRDAHGEEIFEKVETIRKLSKSAQAGNSADRESLIEEI
KSLPDEQLTPVTRAFNQFLNLTNIAEQYHTISRHCEEHICEPDAINSLFSKLVQNDVSKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSFKERKKTERRLEQ
LIVQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVCNDKVR
ELAGEDQHEPYRAILKQLRSLLNETKDILDAKVHGQKLAVKAPLQKVEQLWEPLYACYQS
LNECGMGVIANGSLLDTLRRVKAFGIHLVRLDIRQESTRHADVLSELTRYLGIGDYEQWS
EQDKIAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIVAAQPREAFGAYVISMARTASD
VLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAEAVIKQLMGIDLYRGFIQNHQMVMIGYS
DSAKDAGVMSAGWAQYHAMDSLVKVAEEEGVELTLFHGRGGTIGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQEWRDLMDVLSE
VSCESYRSVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSVDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCNMDISRYY
DQRLVDEPLQPLGDRLREQLQRDIKSVLNVENNENLMQSDPWGLESIRLRNIYVEPLNML
QAELLYRTRQTEEASANLEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatacgccgcactcaaaagtaatgtgcgcatgttgggccaccttctgggt
aacacgattcgtgatgctcatggcgaagaaatcttcgagaaagtggaaaccattcgtaaa
ttatccaaatcggctcaagctggaaatagcgctgacagagaaagcttaatagaagaaatt
aaaagcttgccagatgagcaattgacgcccgttactcgcgcgttcaaccaatttctaaac
ctgaccaatattgctgagcaataccacaccatttcacgccactgtgaagagcatatctgc
gaacctgacgcaattaactcgctgttctcaaagctggtgcaaaatgatgtaagcaagtta
gacacggcacaagcggttcgtgacctgaacattgaattagttctcactgcgcacccgacc
gaaatcactcgtcgcaccatgatcaacaaactggtgaagatcaacgagtgcctatctaag
ctagagctgagcgatctctctttcaaagagcgtaaaaaaactgaacgtcgccttgagcag
ctgatcgttcaaagctggcactctgacgttattcgtcagcagcgacctacaccgcttgat
gaagctaaatggggctttgcggttgtagaaaactcactatgggaagccgtgcctgacttc
ctacgtgaaatgaacgaccgcctgaaatcttaccttggcgaaggtctaccaattgatgct
cgccctgtgcacttctcatcttggatgggcggtgaccgcgacggtaacccatttgtgacc
cacagtgtgactcgtgaagtactacttctgtctcgttggaaagcggcagacctatacctt
aacgacatcaacgagctgatcagcgaactgtctatgacagtgtgcaacgacaaagttcgt
gagcttgcgggtgaagatcaacacgaaccataccgtgcgatcctaaaacagctacgttca
ctactgaacgaaaccaaagatattctcgacgcgaaagttcacggccagaagctggcagtc
aaagcacctctgcaaaaagtagagcaactttgggaaccactttacgcgtgttaccagtcg
ctaaacgaatgtggcatgggcgtgattgccaacggctcactgctggatacgctgcgccgc
gttaaagccttcggtatccacctagttcgcctcgatattcgtcaagaaagtactcgtcat
gctgacgtgctttctgaattgactcgttacctaggcattggtgactatgagcagtggagc
gagcaagacaagatcgctttcctaaccaacgaacttgcgtctaagcgccctcttctacct
cgtgactgggagccatcagaacccgttaaagaggttttggatacctgtaagattgttgcc
gcacaacctcgtgaagcgtttggagcttacgttatctcaatggcacgtaccgcttctgac
gtacttgccgtgcacctactgctgcaagaagcaggttgcccttaccgcatggacgtatgt
ccactgttcgaaacgctagacgacttgaacaacgcggaagcggttatcaaacagctgatg
ggcatcgacctataccgtggctttatccagaaccaccaaatggtgatgatcggctactct
gactctgcaaaagatgcaggtgtaatgtcagcaggttgggcgcaataccacgcgatggac
tcactggttaaggttgcggaagaagaaggcgttgaactcacactgttccacgggcgtggc
ggtacgattggtcgtggtggcgctccagcacacgctgcactattgtctcaaccacctaag
agtctgaaaggcggtctgcgcgtaacagaacaaggtgagatgatccgctttaagctgggt
ctacctgatgttgccgttaacagcttcaacctgtacgcaagtgcaatccttgaagcaaac
ctactgccaccaccagagcctaagcaagagtggcgtgatctaatggacgtgctgtcagaa
gtgagctgtgaatcttaccgcagtgtcgttcgtggcgaaccagacttcgtgccttacttc
cgccaagcaacacctgagcttgaactaggtaaactgcctctaggttcacgcccagcgaag
cgtaacccgaatggtggtgtagaaagtttgcgtgcaattccatggatcttctcttggagc
caaaaccgtttggttctaccagcatggttaggcgcaggtgaggccattcagtactctgta
gacaaaggtcatcaggcgctactggaagaaatgtgtcgtgaatggccattcttctcaact
cgcctaggtatgcttgagatggtgtacaccaagtgcaacatggatatctctcgttactat
gatcagcgcttggttgatgagccgcttcagccgctgggtgatcgtctacgtgagcaactt
cagcgtgatattaagtcagtactgaatgtagagaacaacgagaacctgatgcaaagcgac
ccttggggcctagagtccattcgcctacgtaacatctacgttgagccattgaacatgctt
caagcggaattgctgtaccgtactcgtcaaacagaagaagcttctgcaaacttagaagaa
gcattgatggtgacgattgctggtatcgcagcaggtatgcgtaacacaggctaa

DBGET integrated database retrieval system