KEGG   Vibrio campbellii: M892_13185Help
Entry
M892_13185        CDS       T02837                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
vca  Vibrio campbellii
Pathway
vca00220  Arginine biosynthesis
vca00250  Alanine, aspartate and glutamate metabolism
vca00471  D-Glutamine and D-glutamate metabolism
vca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M892_13185
   00220 Arginine biosynthesis
    M892_13185
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M892_13185
Enzymes [BR:vca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     M892_13185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGU95307
UniProt: A7MTN6
Position
I:2843907..2844827
Genome map
AA seq 306 aa AA seqDB search
MKPTAQILTDILAEVRPLIGQGKVADYIPALAKVPNTKLGIAVYTNEGEVIKAGDAEESF
SIQSISKALSLTLAMCLYKQEEIWCRVGKEPSGQAFNSMIQLEMEQGIPRNPFINAGAIV
VADLLQSRLSAPRQRLLEFARQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFE
NEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPTQTKQLNALLATCG
LYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTIAVWSPELDASGNSLAGTKALELLAER
IGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctacagcgcaaattttgacagacattctagcggaagttcgccctttaattggt
caaggcaaagtcgccgactacattcccgcattggcaaaagtacccaataccaaactgggt
atcgcggtatacaccaatgaaggtgaagtgattaaagcgggcgatgcagaagagtcgttt
tcgattcagtcgatctcaaaagcgttgagcctgactctggctatgtgtttgtacaagcaa
gaagagatctggtgtcgtgtaggtaaagagccttctggtcaggcgtttaactcgatgatc
cagttagagatggagcagggcattccacgtaacccgttcattaacgccggtgctattgtg
gtcgctgatttgctgcaaagccgtctctctgcgccgcgtcagcgtctattggaatttgct
cgtcagctatctggtgacactcatattgtgtacgacaaagtggttgccgcgtctgaaatg
atgcatggcgaccgcaacgctgcgattgcgtacttgatgcgttcatttggtaacttcgag
aacgaggttatccccgttctgcaaaactactttcatgcttgtgcgttgaagatgagctgt
gtcgatctggcgaagacctttagctacttagccaataaaggcacgtcggtacaaacgggt
aagcctgtggtatcaccaacgcaaaccaagcagttgaatgcattgctagcaacttgtggc
ttgtacgatggtgctggtgaatttgcttaccgcgttggtatgccgggtaagtctggtgtt
ggcggtggcatcatcgctgtcgttccgggtgaaatgacgattgctgtttggtctccagag
cttgatgcatctggtaactcactcgctggtactaaagcgcttgagctacttgccgagcgc
attggtcgttcgattttttaa

DBGET integrated database retrieval system