KEGG   Vibrio campbellii: M892_13875Help
Entry
M892_13875        CDS       T02837                                 

Definition
peptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
vca  Vibrio campbellii
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vca00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M892_13875
Enzymes [BR:vca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     M892_13875
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     M892_13875
Glycosyltransferases [BR:vca01003]
 Polysaccharide
  Bacterial polysaccharide
   M892_13875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2983672..2986062
Genome map
AA seq 796 aa AA seqDB search
MTDTKKPGAKRAPAKKTTSSKTTTAKKSGAKRPRKSPSKKPSNGKRSWLKTIWSFSWKAG
VALAAVLLFVGIYLDSVVKDRFDGQLFDLPTVVYARILNLSPGENITIKEMRNELDVLNY
RKVSQPRYPGEYSSSSTRIELIRRPFEFADGPEPDRHVMLHFSSSGLQRIQSLESKGDLG
YLRIEPKMLGMLEKDQNEQRLFLRRDQFPEVLVDALLATEDRDFYQHDGVSPLAIGRALV
ANIKAGRTVQGGSTLTQQLAKNLFLTRDKTLWRKVREAYIALILDYRYSKDRILEAYLNE
VYLGQSGGDAIHGFALASRYYFGQPIQELRIDQLAMLVGMVKGPSYYNPIRYPERTKTRR
DLVLRLLMQQDMLTAEQYEQAVNRPLDTQSKPRIASRQPAYFQQLNIELKEKVGDNFKAE
TGLRLFTSLDPVSQSKLEQAIAKKVPELAKRAGKDLEAAAVAVDRHSGEIRAMVGGKRVG
YEGFNRALNASRPIGSLVKPAIYLTALEQPEKYNLATTLHDTPLSLKGSKGSVWSPRNFD
RKFRGDVPLYLALANSLNVPTVRLGMELGIPEVSDTLERLGVDKSEIRPVPSMFLGSFSL
TPFEVAQMYQTVTNSGKRAKLSALRSVIDMDGNVLYQSLPRSSQAVDQQAAWLTTYAMKQ
GVAQGTGRFLQSQFAWAALAGKTGTSNDSRDSWFVGVDGREVTTVWLGRDDNKSTKLTGS
SGALRVYAEYLKQRIPERLELPWPKEVTTLGFQKAATGALEMNCRSEYKLPVWDKSGQIK
QQCEKKSNWLNSLFDW
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgactgatactaaaaagcccggtgcaaaacgagcaccagcgaagaaaacaacgtcaagt
aaaacgacaaccgctaagaaaagcggcgcgaagcgaccgagaaaatcgccatcgaaaaag
ccgagtaatggcaagcgctcttggcttaaaactatttggtcatttagctggaaggcgggt
gtcgcgttagctgcggtattgttgtttgttgggatttatctcgatagtgtggttaaagat
cgttttgacggccagttgtttgatctaccaactgtcgtttatgcgcgtatcctcaattta
agtccgggtgagaacattaccatcaaagagatgcgtaatgagcttgatgtattgaactac
cgtaaggtgagtcagcctcgttaccctggtgaatactcttcttcttcaacgcgtattgag
cttattcgtcgtccgttcgagtttgctgatggccctgagcctgatcgtcacgtcatgctg
catttttcaagcagtggtctacagcgcattcaatctttggaatccaaaggcgatcttggt
tacctgcgcattgaacctaagatgctaggaatgttggaaaaagatcagaatgaacagcgc
ctgttcttacgtcgagatcaattcccagaagtgcttgtcgatgcgctgttagcaaccgaa
gaccgtgatttttatcagcatgatggtgtttcgccgctggcgattggccgtgcacttgtt
gctaacatcaaagcgggtcgcaccgttcagggcggcagtaccttgactcagcagctagcg
aaaaacttattcctgacacgcgataaaaccttatggcgaaaagtccgtgaagcatacatt
gctctgattctggactaccgctacagtaaagaccgtattcttgaagcttacctaaacgaa
gtttacttaggtcagagcggtggggatgccattcatggttttgctttggcatcgcgttac
tacttcggtcaaccgattcaagagcttcgtatcgaccaactcgctatgttagttggtatg
gtgaaaggaccgtcttactacaacccaattcgctaccctgagcgcactaaaacccgtcgt
gacttggtattgcgtctgttgatgcaacaagacatgttgactgcagagcagtacgaacaa
gcggtaaatcgcccgctcgatacacagagcaaacctcgtatcgcgagtcgtcagccggcg
tacttccaacaactgaacattgagctgaaagaaaaagtaggtgataacttcaaagctgaa
acaggcttacgtttgtttacttctctcgaccctgtatcgcaaagtaagttagagcaagct
atcgcgaagaaagtccctgagcttgctaaacgtgccggaaaagatctagaagccgctgcc
gttgcggtagatcgccatagtggtgaaatccgtgccatggtcggtggtaaacgcgttggt
tatgaaggctttaaccgtgccttgaatgcgagtcgtccgattggctctttggttaaacct
gccatctatttaaccgcgttagagcaacctgagaaatacaaccttgcaacgaccctgcac
gatacgccgttaagcctaaagggcagtaaaggttcggtttggtcaccacgcaacttcgac
cgtaagttccgtggcgatgtgccgttgtacttagccttagcgaactccctcaatgtacca
acggtacgtttgggtatggagctgggtattccagaagtttcggatactttagagcgattg
ggggttgataagagcgaaattcgcccagtaccttcgatgttccttggttcattctcactg
acaccatttgaagtggcacagatgtatcaaacggtcactaactcaggcaagcgcgctaag
ttatcggcattacgctcggtgatcgacatggatggtaatgtactttaccagtcattgccg
cgctcatctcaagcggttgatcagcaagctgcgtggctaacgacttacgcgatgaagcaa
ggtgttgctcaaggtacgggacgcttcctacaaagccagttcgcatgggctgcgctagcc
ggaaaaacgggtaccagtaacgatagtcgtgacagttggttcgtgggtgtcgatggccgt
gaagtaaccacagtgtggcttggtcgcgatgataacaagtctaccaaactgactggttca
agtggcgcattacgtgtttacgcggaatacctaaagcaacgcatccctgagcgactagag
ttgccttggccaaaagaagtgaccacattaggtttccaaaaagctgctactggcgcgctg
gaaatgaactgtcgcagtgaatacaagctgccagtgtgggacaagtctgggcaaatcaaa
cagcagtgtgagaaaaaatcaaactggttgaatagcttatttgattggtag

DBGET integrated database retrieval system