KEGG   Vibrio campbellii: M892_21260Help
Entry
M892_21260        CDS       T02837                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vca  Vibrio campbellii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M892_21260
Enzymes [BR:vca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     M892_21260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:754405..755322
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDSFGINIRENFKMDGIDITGVKMQPNCPTGIAMIQVADSGENSICISAEANAKLTAE
AIEPDLERIRQADYLLMQLETPMCGIEKAARIAKDAKTNVILNPAPARELSDELLSCIDV
ITPNETEAEVLTGVTVTDDDSAQEAANILHSKGIEIVMITLGAKGVWLSQNGRGEIIPGF
RVEATDTTAAGDTFNGALVTGLLEDLPLESAIKFAHAAAAISVTRFGAQTSIPTRKEVEE
FLEQQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtggtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
ttccctcgccctggcgagacgctgcatggtcgcaactatcaagttatcccaggtggcaag
ggtgccaaccaagctgtggcggcagctcgattaaacgcagacatcggttttattgcgtgt
gttggtgatgattcgttcggcatcaacattcgtgagaacttcaaaatggatggcatcgat
atcactggtgtaaagatgcagccaaactgcccaacaggcattgccatgattcaggtggcg
gacagtggtgagaacagtatttgtatctccgcagaagcgaacgcaaaacttaccgcagaa
gcgattgagcccgacctagagcgcattcgtcaggcagattacttattgatgcaactagaa
acgccaatgtgcggtatcgagaaagcagcgcgaatcgcgaaagatgccaaaaccaacgtg
attctaaacccagcaccagctcgcgaactgtcagatgaattactgtcttgtattgatgtc
atcacaccaaatgaaacggaagcggaagtactcacaggcgtgacggtaacagacgatgat
agcgcacaagaagcggcaaacatcctgcattcgaaaggcattgaaatcgtcatgatcacg
ctcggtgcgaaaggggtgtggttgagtcaaaatggtcgtggtgaaatcattcctggcttc
cgcgtagaagcaacagataccactgcggctggcgatacgtttaatggggcattagtcact
ggtttattggaagacttacctttagaatcagcgattaagtttgcccacgctgcagctgcg
atctcagtaactcgctttggcgcgcaaacctccattccaacccgtaaagaggttgaggag
ttccttgaacaacaataa

DBGET integrated database retrieval system