KEGG   Vibrio campbellii: M892_23240Help
Entry
M892_23240        CDS       T02837                                 

Definition
cytochrome C oxidase subunit II
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vca  Vibrio campbellii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M892_23240
Enzymes [BR:vca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     M892_23240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1183957..1185480)
Genome map
AA seq 507 aa AA seqDB search
MKTFNLKPTLLPLTLLLSSPVMAAQNGTMMQYFHWYVLNDGALWTQVENNAPALSENGFT
ALWLPPAYKGAGGSNDVGYGVYDMYDLGEFDQKGSVRTKYGTKDQYLDAIKAAHANNIQI
YGDVVFNHRGGADGKSWVDTERVDWNNRNIELGDKWIEAWVEFSFPGRNDKYSDFHWTWY
HFDGVDWDDAGKEKAIFKFKGDGKAWDWEVSSEKGNYDYLMYADLDMDHPEVKQELKDWG
DWYLNMTGVDGFRMDAVKHIKYQYLQEWIDYLRQKTSKELFTVGEYWNYDVNNLHNFITK
TSGSMSLFDAPLHMNFYNASRSGGNFDMRRIMDGTLMKDNPVKAVTLVENHDTQPLQALE
SPVDWWFKSLAYAFILLREEGYPSVFYADYYGAQYSDKGHDINMVKVPYIEKLVKARKDY
AYGKQHSYLDHWDVIGWTREGDAEHPNSMAVIMSDGPGGTKWMYTGSPSTRYVDKLGIRT
EEVWTDANGWAEFPVNGGSVSVWVGVK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcaaccttaaacccacacttttacctttaactttgctgctcagttcgcca
gtaatggcggctcaaaatggaaccatgatgcagtatttccattggtatgtgctaaatgac
ggtgcactctggacacaagttgaaaacaacgcgccagcactatcggaaaacggctttacc
gcgttatggctaccgcctgcctataaaggtgctggtggcagcaacgacgtcggttatggc
gtttacgatatgtatgacttgggggagtttgatcaaaaaggatcggtgcgaaccaagtac
ggtacaaaagaccaatacctcgatgccatcaaagcggcacacgcaaacaacattcaaatt
tatggtgatgtggtgtttaaccaccgtggcggtgcggatggtaaatcgtgggtcgacacc
gagcgagtcgattggaacaatcggaacattgaactcggcgacaaatggattgaagcttgg
gtcgaatttagctttccggggcgtaacgacaaatactcagatttccattggacgtggtat
cactttgacggcgttgactgggatgacgcaggtaaagaaaaagcgatcttcaaattcaaa
ggcgatggcaaagcatgggattgggaagtcagttctgaaaaaggcaactatgactacctc
atgtacgcagatttagacatggaccacccagaagtgaagcaagaactgaaagactggggc
gattggtacttaaatatgacgggtgtggatggcttccgaatggacgcagtcaaacacatc
aaatatcaatacctgcaagagtggatcgattacttgcgacagaaaacgagcaaagagttg
tttactgtcggtgagtactggaactacgacgttaacaatctgcacaactttatcaccaag
acgtctggcagtatgtcgttgtttgatgcaccgttacacatgaacttctacaacgcttca
cgctcaggtggtaacttcgacatgcgtcgtatcatggatggtaccttgatgaaggacaac
ccagtgaaagcagtgactctggttgagaaccacgatacgcagcctcttcaagcgctagaa
tctccagtcgattggtggtttaagtctctcgcgtacgcgtttatcttgctacgtgaagag
ggctatccgtcagtcttttatgctgattactacggcgcgcaatacagtgataaagggcac
gacatcaacatggtgaaagtgccgtatattgagaaattggtgaaagcccgtaaagattat
gcttatggcaagcagcactcttaccttgatcattgggatgtgattggttggacgcgagaa
ggggatgcagaacacccgaactcaatggcggttatcatgagtgatggccctggcggtaca
aaatggatgtacacaggttcaccaagtacgcgttacgtcgataagttaggtattcgcacg
gaagaagtttggactgacgccaacggttgggcagagttcccagtgaacggtggttcggtt
tctgtttgggtcggcgttaaataa

DBGET integrated database retrieval system